Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1854622..1855265 | Replicon | chromosome |
| Accession | NZ_CP126994 | ||
| Organism | Acidisoma sp. PAMC 29798 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QP803_RS08910 | Protein ID | WP_284947412.1 |
| Coordinates | 1854622..1855011 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QP803_RS08915 | Protein ID | WP_284947413.1 |
| Coordinates | 1855026..1855265 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP803_RS08885 | 1850354..1850656 | - | 303 | WP_284947407.1 | putative addiction module antidote protein | - |
| QP803_RS08890 | 1850631..1850957 | - | 327 | WP_284947408.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QP803_RS08895 | 1851005..1852465 | - | 1461 | WP_284947409.1 | exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | - |
| QP803_RS08900 | 1852551..1853900 | - | 1350 | WP_284947410.1 | adenylosuccinate lyase | - |
| QP803_RS08905 | 1853990..1854616 | + | 627 | WP_284947411.1 | YjbE family putative metal transport protein | - |
| QP803_RS08910 | 1854622..1855011 | - | 390 | WP_284947412.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QP803_RS08915 | 1855026..1855265 | - | 240 | WP_284947413.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QP803_RS08920 | 1855325..1856104 | - | 780 | WP_284947414.1 | ATP-binding cassette domain-containing protein | - |
| QP803_RS08925 | 1856101..1856886 | - | 786 | WP_284947415.1 | ABC transporter permease | - |
| QP803_RS08930 | 1856883..1857950 | - | 1068 | WP_284947416.1 | alanine racemase | - |
| QP803_RS08935 | 1857952..1859229 | - | 1278 | WP_284947417.1 | NAD(P)/FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13859.96 Da Isoelectric Point: 6.2188
>T283478 WP_284947412.1 NZ_CP126994:c1855011-1854622 [Acidisoma sp. PAMC 29798]
MLDTNIVSDLIRNPVGRVAEQLLLHGNDGLCLSIITAAELRYGAAKKGSDRLSARVSAVLGTLDILPFDSPADAEYGKLR
AALEAAGTPIRPTDLFIAAHALALQVTLVTHNVSEFRWVRGLTVENWLA
MLDTNIVSDLIRNPVGRVAEQLLLHGNDGLCLSIITAAELRYGAAKKGSDRLSARVSAVLGTLDILPFDSPADAEYGKLR
AALEAAGTPIRPTDLFIAAHALALQVTLVTHNVSEFRWVRGLTVENWLA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|