Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 1832346..1832937 | Replicon | chromosome |
| Accession | NZ_CP126994 | ||
| Organism | Acidisoma sp. PAMC 29798 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | QP803_RS08795 | Protein ID | WP_284947391.1 |
| Coordinates | 1832629..1832937 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | QP803_RS08790 | Protein ID | WP_284947390.1 |
| Coordinates | 1832346..1832648 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP803_RS08765 | 1827958..1829211 | + | 1254 | WP_284947385.1 | sodium:proton antiporter | - |
| QP803_RS08770 | 1829234..1830031 | - | 798 | WP_284947386.1 | tetratricopeptide repeat protein | - |
| QP803_RS08775 | 1830145..1830657 | - | 513 | WP_284947387.1 | DedA family protein | - |
| QP803_RS08780 | 1830737..1831672 | - | 936 | WP_284947388.1 | ferritin-like domain-containing protein | - |
| QP803_RS08785 | 1831751..1832218 | - | 468 | WP_284947389.1 | hypothetical protein | - |
| QP803_RS08790 | 1832346..1832648 | - | 303 | WP_284947390.1 | BrnA antitoxin family protein | Antitoxin |
| QP803_RS08795 | 1832629..1832937 | - | 309 | WP_284947391.1 | BrnT family toxin | Toxin |
| QP803_RS08800 | 1832982..1834496 | - | 1515 | WP_284947392.1 | DNA polymerase Y family protein | - |
| QP803_RS08805 | 1834417..1835139 | - | 723 | WP_284947393.1 | damage-inducible mutagenesis protein | - |
| QP803_RS08810 | 1835420..1835962 | - | 543 | WP_284947394.1 | hypothetical protein | - |
| QP803_RS08815 | 1836189..1837160 | - | 972 | WP_284947395.1 | spore coat protein U domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11946.40 Da Isoelectric Point: 6.0906
>T283477 WP_284947391.1 NZ_CP126994:c1832937-1832629 [Acidisoma sp. PAMC 29798]
MAGIRFEWDEAKSRSNQRKHGLSFEEASQVFNDPMHFSVLDRIEGHEYRWRTLGLIGGFMILMVAHTMTETDAEGDSIDV
IRIISARRADRMERRRYENENG
MAGIRFEWDEAKSRSNQRKHGLSFEEASQVFNDPMHFSVLDRIEGHEYRWRTLGLIGGFMILMVAHTMTETDAEGDSIDV
IRIISARRADRMERRRYENENG
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|