Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1430763..1431424 | Replicon | chromosome |
| Accession | NZ_CP126994 | ||
| Organism | Acidisoma sp. PAMC 29798 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QP803_RS06870 | Protein ID | WP_284947042.1 |
| Coordinates | 1431020..1431424 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QP803_RS06865 | Protein ID | WP_284947041.1 |
| Coordinates | 1430763..1431023 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP803_RS06850 | 1426263..1428770 | - | 2508 | WP_284947038.1 | FAD-dependent oxidoreductase | - |
| QP803_RS06855 | 1428861..1430285 | - | 1425 | WP_284947039.1 | amidase | - |
| QP803_RS06860 | 1430282..1430686 | - | 405 | WP_284947040.1 | VOC family protein | - |
| QP803_RS06865 | 1430763..1431023 | + | 261 | WP_284947041.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QP803_RS06870 | 1431020..1431424 | + | 405 | WP_284947042.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QP803_RS06875 | 1431438..1432544 | - | 1107 | WP_284947843.1 | hybrid-cluster NAD(P)-dependent oxidoreductase | - |
| QP803_RS06880 | 1432554..1433834 | - | 1281 | WP_284947043.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
| QP803_RS06885 | 1433950..1435056 | - | 1107 | WP_284947044.1 | GlxA family transcriptional regulator | - |
| QP803_RS06890 | 1435097..1435906 | - | 810 | WP_284947045.1 | transglutaminase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14886.25 Da Isoelectric Point: 7.1668
>T283474 WP_284947042.1 NZ_CP126994:1431020-1431424 [Acidisoma sp. PAMC 29798]
MTRYMLDTNTVSYFVKEQAEVVRRVISVPMSSLCLSAITEGELLFGLAKRPSATRLHRSVRELLRRIDVLPWTSATAERY
GVERAQMAREGRILAPIDLLIAAHALSVGAVLVTNDQVFASVTDLIVEDWTQAA
MTRYMLDTNTVSYFVKEQAEVVRRVISVPMSSLCLSAITEGELLFGLAKRPSATRLHRSVRELLRRIDVLPWTSATAERY
GVERAQMAREGRILAPIDLLIAAHALSVGAVLVTNDQVFASVTDLIVEDWTQAA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|