Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1293424..1294055 | Replicon | chromosome |
Accession | NZ_CP126994 | ||
Organism | Acidisoma sp. PAMC 29798 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QP803_RS06220 | Protein ID | WP_284946918.1 |
Coordinates | 1293663..1294055 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QP803_RS06215 | Protein ID | WP_284946917.1 |
Coordinates | 1293424..1293666 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP803_RS06200 | 1288617..1290323 | + | 1707 | WP_284946914.1 | GGDEF domain-containing protein | - |
QP803_RS06205 | 1290459..1291805 | + | 1347 | WP_284946915.1 | chloride channel protein | - |
QP803_RS06210 | 1291790..1293256 | - | 1467 | WP_284946916.1 | mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | - |
QP803_RS06215 | 1293424..1293666 | + | 243 | WP_284946917.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QP803_RS06220 | 1293663..1294055 | + | 393 | WP_284946918.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QP803_RS06225 | 1294052..1295446 | - | 1395 | WP_284946919.1 | MFS transporter | - |
QP803_RS06230 | 1295460..1296680 | - | 1221 | WP_284946920.1 | MFS transporter | - |
QP803_RS06235 | 1296712..1297722 | - | 1011 | WP_284946921.1 | RluA family pseudouridine synthase | - |
QP803_RS06240 | 1297762..1298049 | + | 288 | WP_284946922.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14391.54 Da Isoelectric Point: 6.9894
>T283473 WP_284946918.1 NZ_CP126994:1293663-1294055 [Acidisoma sp. PAMC 29798]
VIYLLDSNAVIALFAGHLGFITRLKHHRPTDVGLSSIVAHELYFGAYKSRKQAENLARVEAHLFEVLPFDQQDARQAGEL
RAALSVSGTPIGPYDVLIAGQALAKGLTLITRNLREFERVPSLLVENWEV
VIYLLDSNAVIALFAGHLGFITRLKHHRPTDVGLSSIVAHELYFGAYKSRKQAENLARVEAHLFEVLPFDQQDARQAGEL
RAALSVSGTPIGPYDVLIAGQALAKGLTLITRNLREFERVPSLLVENWEV
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|