Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataT-TacA2/DUF1778(antitoxin) |
Location | 140700..141463 | Replicon | chromosome |
Accession | NZ_CP126994 | ||
Organism | Acidisoma sp. PAMC 29798 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | QP803_RS00710 | Protein ID | WP_284945770.1 |
Coordinates | 140700..141197 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | QP803_RS00715 | Protein ID | WP_284945771.1 |
Coordinates | 141185..141463 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP803_RS00685 | 135729..136844 | + | 1116 | WP_284945766.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
QP803_RS00690 | 136934..137563 | + | 630 | WP_284947784.1 | GTP cyclohydrolase II RibA | - |
QP803_RS00695 | 137653..138540 | + | 888 | WP_284945767.1 | formyltetrahydrofolate deformylase | - |
QP803_RS00700 | 138547..139422 | + | 876 | WP_284945768.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
QP803_RS00705 | 139431..140636 | - | 1206 | WP_284945769.1 | MFS transporter | - |
QP803_RS00710 | 140700..141197 | - | 498 | WP_284945770.1 | GNAT family N-acetyltransferase | Toxin |
QP803_RS00715 | 141185..141463 | - | 279 | WP_284945771.1 | DUF1778 domain-containing protein | Antitoxin |
QP803_RS00720 | 141515..142753 | - | 1239 | WP_284945772.1 | arsenic transporter | - |
QP803_RS00725 | 142759..144483 | - | 1725 | WP_284945773.1 | NADPH-dependent assimilatory sulfite reductase hemoprotein subunit | - |
QP803_RS00730 | 144494..146287 | - | 1794 | WP_284945774.1 | flavodoxin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17824.69 Da Isoelectric Point: 9.7355
>T283472 WP_284945770.1 NZ_CP126994:c141197-140700 [Acidisoma sp. PAMC 29798]
MGAVIQPPTRLTAAHDVSNFTCRESALNEWLLKQALRNEGRLSRSYVTCVDHQVVGFYCLVNGAVRRDAAVSKLRRNAPD
PVPVMIIGRLAVDQAWEGRGLGRGLLRDAILRTLGASEIAGIAALLVHAISPGARRFYEGSGFVASELERMTLMISLKDA
AALLG
MGAVIQPPTRLTAAHDVSNFTCRESALNEWLLKQALRNEGRLSRSYVTCVDHQVVGFYCLVNGAVRRDAAVSKLRRNAPD
PVPVMIIGRLAVDQAWEGRGLGRGLLRDAILRTLGASEIAGIAALLVHAISPGARRFYEGSGFVASELERMTLMISLKDA
AALLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|