Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | AbkB-brnA/BrnT-BrnA |
| Location | 42591..43197 | Replicon | chromosome |
| Accession | NZ_CP126994 | ||
| Organism | Acidisoma sp. PAMC 29798 | ||
Toxin (Protein)
| Gene name | AbkB | Uniprot ID | - |
| Locus tag | QP803_RS00200 | Protein ID | WP_284945674.1 |
| Coordinates | 42901..43197 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | - |
| Locus tag | QP803_RS00195 | Protein ID | WP_284945673.1 |
| Coordinates | 42591..42920 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP803_RS00175 | 37876..39114 | + | 1239 | WP_284945669.1 | ADP-dependent glucokinase/phosphofructokinase | - |
| QP803_RS00180 | 39101..40123 | + | 1023 | WP_284945670.1 | hypothetical protein | - |
| QP803_RS00185 | 40151..41551 | + | 1401 | WP_284945671.1 | FAD-binding oxidoreductase | - |
| QP803_RS00190 | 41553..42512 | - | 960 | WP_284945672.1 | alpha/beta hydrolase | - |
| QP803_RS00195 | 42591..42920 | - | 330 | WP_284945673.1 | BrnA antitoxin family protein | Antitoxin |
| QP803_RS00200 | 42901..43197 | - | 297 | WP_284945674.1 | BrnT family toxin | Toxin |
| QP803_RS00205 | 43363..43824 | + | 462 | WP_284945675.1 | VOC family protein | - |
| QP803_RS00210 | 43959..45146 | + | 1188 | WP_284945676.1 | MFS transporter | - |
| QP803_RS00215 | 45166..45732 | + | 567 | WP_284945677.1 | cytochrome b | - |
| QP803_RS00220 | 45738..47993 | - | 2256 | WP_284945678.1 | xanthine dehydrogenase family protein molybdopterin-binding subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11217.55 Da Isoelectric Point: 6.4830
>T283471 WP_284945674.1 NZ_CP126994:c43197-42901 [Acidisoma sp. PAMC 29798]
MISRWTWNLRKDQTNRRDHGGLSLADGMPVLDGDPHQLSRPDTHPDGDRWQTIGMALDVLLLFVVHTEPDDRRDGIGRII
SVRRASPQERKAYEEGAF
MISRWTWNLRKDQTNRRDHGGLSLADGMPVLDGDPHQLSRPDTHPDGDRWQTIGMALDVLLLFVVHTEPDDRRDGIGRII
SVRRASPQERKAYEEGAF
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|