Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/COG3657-dnstrm_HI1420
Location 6626..7218 Replicon plasmid pPan126A
Accession NZ_CP126993
Organism Pseudomonas syringae pv. antirrhini str. 126

Toxin (Protein)


Gene name PumA Uniprot ID -
Locus tag QQF68_RS27850 Protein ID WP_285362783.1
Coordinates 6916..7218 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID A0A2P0QFH5
Locus tag QQF68_RS27845 Protein ID WP_074321561.1
Coordinates 6626..6919 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQF68_RS27805 (QQF68_27805) 2045..2302 + 258 WP_122223017.1 hypothetical protein -
QQF68_RS27810 (QQF68_27810) 2295..2738 + 444 WP_122223019.1 hypothetical protein -
QQF68_RS27815 (QQF68_27815) 2735..3145 + 411 WP_122223021.1 hypothetical protein -
QQF68_RS27820 (QQF68_27820) 3726..3935 + 210 WP_122223027.1 hypothetical protein -
QQF68_RS27825 (QQF68_27825) 4034..4162 + 129 WP_259641459.1 hypothetical protein -
QQF68_RS27830 (QQF68_27830) 4192..4542 + 351 WP_122223029.1 hypothetical protein -
QQF68_RS27835 (QQF68_27835) 4733..5041 + 309 WP_122223031.1 hypothetical protein -
QQF68_RS27840 (QQF68_27840) 5329..5634 + 306 WP_122223033.1 hypothetical protein -
QQF68_RS27845 (QQF68_27845) 6626..6919 - 294 WP_074321561.1 putative addiction module antidote protein Antitoxin
QQF68_RS27850 (QQF68_27850) 6916..7218 - 303 WP_285362783.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QQF68_RS27855 (QQF68_27855) 7337..7780 + 444 WP_285390788.1 hypothetical protein -
QQF68_RS27860 (QQF68_27860) 7811..8179 + 369 WP_285362781.1 hypothetical protein -
QQF68_RS27865 (QQF68_27865) 8368..9204 + 837 WP_074321554.1 DUF932 domain-containing protein -
QQF68_RS27870 (QQF68_27870) 9262..9699 + 438 WP_074321552.1 hypothetical protein -
QQF68_RS27875 (QQF68_27875) 9834..10130 + 297 WP_074321550.1 TrfB-related DNA-binding protein -
QQF68_RS27880 (QQF68_27880) 11066..11497 + 432 WP_122222970.1 hypothetical protein -
QQF68_RS27885 (QQF68_27885) 11581..11892 + 312 WP_122222968.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..60179 60179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-95)

Antitoxin

Uncharacterized protein HI1420

(5-91)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11120.60 Da        Isoelectric Point: 9.5982

>T283470 WP_285362783.1 NZ_CP126993:c7218-6916 [Pseudomonas syringae pv. antirrhini str. 126]
MNTIKQTATFRTWESKLKDNRAKAAIAARILRVANGLMGDVSPVGQGVSELRIHYGPGYRVYFQQRGNELVILLCGGDKS
SQARDIETAKTLAHDWSENE

Download         Length: 303 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10191.65 Da        Isoelectric Point: 5.0197

>AT283470 WP_074321561.1 NZ_CP126993:c6919-6626 [Pseudomonas syringae pv. antirrhini str. 126]
MKESLYDYDPAAALVDAESITVFIADAFETGDAAHIAQALGVVARAKGMSEIAKVSGLSRESLYVAFSDKGNPTLKTMLA
VMRAVGVDMTARAHSPT

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2P0QFH5

References