Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 6626..7218 | Replicon | plasmid pPan126A |
| Accession | NZ_CP126993 | ||
| Organism | Pseudomonas syringae pv. antirrhini str. 126 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | QQF68_RS27850 | Protein ID | WP_285362783.1 |
| Coordinates | 6916..7218 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A2P0QFH5 |
| Locus tag | QQF68_RS27845 | Protein ID | WP_074321561.1 |
| Coordinates | 6626..6919 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQF68_RS27805 (QQF68_27805) | 2045..2302 | + | 258 | WP_122223017.1 | hypothetical protein | - |
| QQF68_RS27810 (QQF68_27810) | 2295..2738 | + | 444 | WP_122223019.1 | hypothetical protein | - |
| QQF68_RS27815 (QQF68_27815) | 2735..3145 | + | 411 | WP_122223021.1 | hypothetical protein | - |
| QQF68_RS27820 (QQF68_27820) | 3726..3935 | + | 210 | WP_122223027.1 | hypothetical protein | - |
| QQF68_RS27825 (QQF68_27825) | 4034..4162 | + | 129 | WP_259641459.1 | hypothetical protein | - |
| QQF68_RS27830 (QQF68_27830) | 4192..4542 | + | 351 | WP_122223029.1 | hypothetical protein | - |
| QQF68_RS27835 (QQF68_27835) | 4733..5041 | + | 309 | WP_122223031.1 | hypothetical protein | - |
| QQF68_RS27840 (QQF68_27840) | 5329..5634 | + | 306 | WP_122223033.1 | hypothetical protein | - |
| QQF68_RS27845 (QQF68_27845) | 6626..6919 | - | 294 | WP_074321561.1 | putative addiction module antidote protein | Antitoxin |
| QQF68_RS27850 (QQF68_27850) | 6916..7218 | - | 303 | WP_285362783.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQF68_RS27855 (QQF68_27855) | 7337..7780 | + | 444 | WP_285390788.1 | hypothetical protein | - |
| QQF68_RS27860 (QQF68_27860) | 7811..8179 | + | 369 | WP_285362781.1 | hypothetical protein | - |
| QQF68_RS27865 (QQF68_27865) | 8368..9204 | + | 837 | WP_074321554.1 | DUF932 domain-containing protein | - |
| QQF68_RS27870 (QQF68_27870) | 9262..9699 | + | 438 | WP_074321552.1 | hypothetical protein | - |
| QQF68_RS27875 (QQF68_27875) | 9834..10130 | + | 297 | WP_074321550.1 | TrfB-related DNA-binding protein | - |
| QQF68_RS27880 (QQF68_27880) | 11066..11497 | + | 432 | WP_122222970.1 | hypothetical protein | - |
| QQF68_RS27885 (QQF68_27885) | 11581..11892 | + | 312 | WP_122222968.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..60179 | 60179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11120.60 Da Isoelectric Point: 9.5982
>T283470 WP_285362783.1 NZ_CP126993:c7218-6916 [Pseudomonas syringae pv. antirrhini str. 126]
MNTIKQTATFRTWESKLKDNRAKAAIAARILRVANGLMGDVSPVGQGVSELRIHYGPGYRVYFQQRGNELVILLCGGDKS
SQARDIETAKTLAHDWSENE
MNTIKQTATFRTWESKLKDNRAKAAIAARILRVANGLMGDVSPVGQGVSELRIHYGPGYRVYFQQRGNELVILLCGGDKS
SQARDIETAKTLAHDWSENE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|