Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 5872018..5872537 | Replicon | chromosome |
| Accession | NZ_CP126992 | ||
| Organism | Pseudomonas syringae pv. antirrhini str. 126 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QQF68_RS26390 | Protein ID | WP_057418387.1 |
| Coordinates | 5872018..5872308 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S6UWW5 |
| Locus tag | QQF68_RS26395 | Protein ID | WP_002551444.1 |
| Coordinates | 5872298..5872537 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQF68_RS26365 (QQF68_26365) | 5868980..5869609 | + | 630 | WP_024667558.1 | NAD(P)H-dependent oxidoreductase | - |
| QQF68_RS26370 (QQF68_26370) | 5869666..5870280 | - | 615 | WP_057418385.1 | histidine phosphatase family protein | - |
| QQF68_RS26375 (QQF68_26375) | 5870358..5870699 | - | 342 | WP_003380754.1 | DUF5713 family protein | - |
| QQF68_RS26380 (QQF68_26380) | 5871054..5871791 | + | 738 | WP_057418386.1 | hypothetical protein | - |
| QQF68_RS26385 (QQF68_26385) | 5871813..5871950 | - | 138 | Protein_5199 | GNAT family N-acetyltransferase | - |
| QQF68_RS26390 (QQF68_26390) | 5872018..5872308 | - | 291 | WP_057418387.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQF68_RS26395 (QQF68_26395) | 5872298..5872537 | - | 240 | WP_002551444.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QQF68_RS26400 (QQF68_26400) | 5872713..5873174 | - | 462 | WP_057418388.1 | GNAT family N-acetyltransferase | - |
| QQF68_RS26405 (QQF68_26405) | 5873547..5874041 | + | 495 | WP_010209025.1 | hypothetical protein | - |
| QQF68_RS26410 (QQF68_26410) | 5874081..5875355 | - | 1275 | WP_005769894.1 | OprD family porin | - |
| QQF68_RS26415 (QQF68_26415) | 5875585..5875791 | - | 207 | WP_044392902.1 | hypothetical protein | - |
| QQF68_RS26420 (QQF68_26420) | 5876011..5877117 | - | 1107 | WP_057418389.1 | agmatine deiminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11153.95 Da Isoelectric Point: 9.9154
>T283469 WP_057418387.1 NZ_CP126992:c5872308-5872018 [Pseudomonas syringae pv. antirrhini str. 126]
MTYSLEFDARALKEWDKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLSG
MTYSLEFDARALKEWDKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLSG
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|