Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 5872018..5872537 Replicon chromosome
Accession NZ_CP126992
Organism Pseudomonas syringae pv. antirrhini str. 126

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QQF68_RS26390 Protein ID WP_057418387.1
Coordinates 5872018..5872308 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S6UWW5
Locus tag QQF68_RS26395 Protein ID WP_002551444.1
Coordinates 5872298..5872537 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQF68_RS26365 (QQF68_26365) 5868980..5869609 + 630 WP_024667558.1 NAD(P)H-dependent oxidoreductase -
QQF68_RS26370 (QQF68_26370) 5869666..5870280 - 615 WP_057418385.1 histidine phosphatase family protein -
QQF68_RS26375 (QQF68_26375) 5870358..5870699 - 342 WP_003380754.1 DUF5713 family protein -
QQF68_RS26380 (QQF68_26380) 5871054..5871791 + 738 WP_057418386.1 hypothetical protein -
QQF68_RS26385 (QQF68_26385) 5871813..5871950 - 138 Protein_5199 GNAT family N-acetyltransferase -
QQF68_RS26390 (QQF68_26390) 5872018..5872308 - 291 WP_057418387.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QQF68_RS26395 (QQF68_26395) 5872298..5872537 - 240 WP_002551444.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QQF68_RS26400 (QQF68_26400) 5872713..5873174 - 462 WP_057418388.1 GNAT family N-acetyltransferase -
QQF68_RS26405 (QQF68_26405) 5873547..5874041 + 495 WP_010209025.1 hypothetical protein -
QQF68_RS26410 (QQF68_26410) 5874081..5875355 - 1275 WP_005769894.1 OprD family porin -
QQF68_RS26415 (QQF68_26415) 5875585..5875791 - 207 WP_044392902.1 hypothetical protein -
QQF68_RS26420 (QQF68_26420) 5876011..5877117 - 1107 WP_057418389.1 agmatine deiminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11153.95 Da        Isoelectric Point: 9.9154

>T283469 WP_057418387.1 NZ_CP126992:c5872308-5872018 [Pseudomonas syringae pv. antirrhini str. 126]
MTYSLEFDARALKEWDKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLSG

Download         Length: 291 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8955.34 Da        Isoelectric Point: 4.6017

>AT283469 WP_002551444.1 NZ_CP126992:c5872537-5872298 [Pseudomonas syringae pv. antirrhini str. 126]
MASINVRIDDDLKARAYLELEKLGVTPSELLRQTLQYVAERGQLPFKTVLMTEEDEALLATVRERLAAPQRVKVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0K8M1G9

References