Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4392211..4392833 | Replicon | chromosome |
| Accession | NZ_CP126992 | ||
| Organism | Pseudomonas syringae pv. antirrhini str. 126 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q886E5 |
| Locus tag | QQF68_RS19815 | Protein ID | WP_011103638.1 |
| Coordinates | 4392651..4392833 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QQF68_RS19810 | Protein ID | WP_057418502.1 |
| Coordinates | 4392211..4392615 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQF68_RS19795 (QQF68_19795) | 4387981..4388649 | + | 669 | WP_057418504.1 | ABC transporter ATP-binding protein | - |
| QQF68_RS19800 (QQF68_19800) | 4388649..4391126 | + | 2478 | WP_011103640.1 | FtsX-like permease family protein | - |
| QQF68_RS19805 (QQF68_19805) | 4391116..4392195 | + | 1080 | WP_057418503.1 | lipocalin-like domain-containing protein | - |
| QQF68_RS19810 (QQF68_19810) | 4392211..4392615 | - | 405 | WP_057418502.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QQF68_RS19815 (QQF68_19815) | 4392651..4392833 | - | 183 | WP_011103638.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QQF68_RS19820 (QQF68_19820) | 4393118..4394890 | + | 1773 | WP_057418501.1 | N-acetylglutaminylglutamine amidotransferase | - |
| QQF68_RS19825 (QQF68_19825) | 4394894..4396642 | + | 1749 | WP_044392447.1 | N-acetylglutaminylglutamine synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6675.81 Da Isoelectric Point: 10.6643
>T283468 WP_011103638.1 NZ_CP126992:c4392833-4392651 [Pseudomonas syringae pv. antirrhini str. 126]
VQSRQLVKELEADGWVLDRVTGSHHMFKHPEKSQTVPVPHPKKDLPLGTVKAIRKLAGLA
VQSRQLVKELEADGWVLDRVTGSHHMFKHPEKSQTVPVPHPKKDLPLGTVKAIRKLAGLA
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14386.41 Da Isoelectric Point: 4.7182
>AT283468 WP_057418502.1 NZ_CP126992:c4392615-4392211 [Pseudomonas syringae pv. antirrhini str. 126]
MKYPICIEWGDETTAFGIQIPDIPGAITAGDTFEEAHAAAVEIAHIMLQEIAASGGSIPKVGTVAEHAKNPDFSGMGWGM
LEIDVTPYLGKTEKVNVTLPGFVIRQIDSYVRDHSIKSRSTFLADAALEKLGRA
MKYPICIEWGDETTAFGIQIPDIPGAITAGDTFEEAHAAAVEIAHIMLQEIAASGGSIPKVGTVAEHAKNPDFSGMGWGM
LEIDVTPYLGKTEKVNVTLPGFVIRQIDSYVRDHSIKSRSTFLADAALEKLGRA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|