Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 2018524..2019037 | Replicon | chromosome |
| Accession | NZ_CP126992 | ||
| Organism | Pseudomonas syringae pv. antirrhini str. 126 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QQF68_RS09310 | Protein ID | WP_080395495.1 |
| Coordinates | 2018524..2018808 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S6UR83 |
| Locus tag | QQF68_RS09315 | Protein ID | WP_005740683.1 |
| Coordinates | 2018798..2019037 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQF68_RS09290 (QQF68_09290) | 2013933..2014418 | + | 486 | WP_007245243.1 | DUF2269 domain-containing protein | - |
| QQF68_RS09295 (QQF68_09295) | 2014670..2016598 | + | 1929 | WP_057418442.1 | methyl-accepting chemotaxis protein | - |
| QQF68_RS09300 (QQF68_09300) | 2016627..2017559 | - | 933 | WP_057418441.1 | DMT family transporter | - |
| QQF68_RS09305 (QQF68_09305) | 2017634..2018488 | + | 855 | WP_057418440.1 | LysR family transcriptional regulator | - |
| QQF68_RS09310 (QQF68_09310) | 2018524..2018808 | - | 285 | WP_080395495.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQF68_RS09315 (QQF68_09315) | 2018798..2019037 | - | 240 | WP_005740683.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QQF68_RS09320 (QQF68_09320) | 2019206..2020222 | - | 1017 | WP_003376162.1 | 1-aminocyclopropane-1-carboxylate deaminase | - |
| QQF68_RS09325 (QQF68_09325) | 2020388..2020894 | + | 507 | WP_024666116.1 | winged helix-turn-helix transcriptional regulator | - |
| QQF68_RS09330 (QQF68_09330) | 2021042..2021950 | + | 909 | WP_054089894.1 | DUF808 domain-containing protein | - |
| QQF68_RS09335 (QQF68_09335) | 2022076..2022861 | - | 786 | WP_005765329.1 | outer membrane protein OmpK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10798.55 Da Isoelectric Point: 10.4223
>T283467 WP_080395495.1 NZ_CP126992:c2018808-2018524 [Pseudomonas syringae pv. antirrhini str. 126]
MQVEWLKTALKNLDDEAAYISLENPAAAVAFVEAIQISVKQLASFPALGREGRIAGTREWPLPDWSYLIPYRIRNGRLQV
LRIFHTRRQPPLVR
MQVEWLKTALKNLDDEAAYISLENPAAAVAFVEAIQISVKQLASFPALGREGRIAGTREWPLPDWSYLIPYRIRNGRLQV
LRIFHTRRQPPLVR
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|