Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 994458..995092 Replicon chromosome
Accession NZ_CP126992
Organism Pseudomonas syringae pv. antirrhini str. 126

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QQF68_RS04680 Protein ID WP_005770950.1
Coordinates 994458..994862 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q888H8
Locus tag QQF68_RS04685 Protein ID WP_003380366.1
Coordinates 994862..995092 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQF68_RS04650 (QQF68_04650) 990343..990825 + 483 WP_002556144.1 PAS domain-containing protein -
QQF68_RS04655 (QQF68_04655) 990921..992177 + 1257 WP_007244165.1 3-phosphoshikimate 1-carboxyvinyltransferase -
QQF68_RS04660 (QQF68_04660) 992200..992862 - 663 WP_054090834.1 ChrR family anti-sigma-E factor -
QQF68_RS04665 (QQF68_04665) 992862..993374 - 513 WP_005615033.1 sigma-70 family RNA polymerase sigma factor -
QQF68_RS04670 (QQF68_04670) 993435..994274 + 840 WP_162236207.1 hypothetical protein -
QQF68_RS04675 (QQF68_04675) 994307..994426 - 120 Protein_909 aldose 1-epimerase -
QQF68_RS04680 (QQF68_04680) 994458..994862 - 405 WP_005770950.1 tRNA(fMet)-specific endonuclease VapC Toxin
QQF68_RS04685 (QQF68_04685) 994862..995092 - 231 WP_003380366.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQF68_RS04690 (QQF68_04690) 995206..996087 - 882 WP_057418857.1 aldose 1-epimerase -
QQF68_RS04695 (QQF68_04695) 996062..997033 - 972 WP_057418858.1 DMT family transporter -
QQF68_RS04700 (QQF68_04700) 997117..998397 - 1281 WP_024665964.1 TRAP transporter large permease -
QQF68_RS04705 (QQF68_04705) 998398..998925 - 528 WP_005770954.1 TRAP transporter small permease -
QQF68_RS04710 (QQF68_04710) 998989..1000014 - 1026 WP_005770956.1 TRAP transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-34)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14858.10 Da        Isoelectric Point: 6.4779

>T283466 WP_005770950.1 NZ_CP126992:c994862-994458 [Pseudomonas syringae pv. antirrhini str. 126]
MLKYMLDTNICIFTIKNKPVSVREAFNLHHGQLCISAITLMELVYGAEKSSSPERNLAVVEGFAARLELLPYDSDAAAHT
GMIRAELARAGTPIGPYDQMIAGHARSLGLVVITNNQREFQRVEGLRVEDWVSQ

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8593.67 Da        Isoelectric Point: 4.5557

>AT283466 WP_003380366.1 NZ_CP126992:c995092-994862 [Pseudomonas syringae pv. antirrhini str. 126]
MEQSTVFKSNRSQAVRLPKAVALPDDVKRVDVVAVGRTRIISPAGEMWNSWFDGESVSDDFMAEREQPVEQLRESL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0K8LU44

References