Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4004235..4004854 Replicon chromosome
Accession NZ_CP126987
Organism Klebsiella pneumoniae subsp. pneumoniae strain T3

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QP573_RS19465 Protein ID WP_002892050.1
Coordinates 4004636..4004854 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QP573_RS19460 Protein ID WP_002892066.1
Coordinates 4004235..4004609 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP573_RS19450 (3999387) 3999387..4000580 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QP573_RS19455 (4000603) 4000603..4003749 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QP573_RS19460 (4004235) 4004235..4004609 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QP573_RS19465 (4004636) 4004636..4004854 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QP573_RS19470 (4005017) 4005017..4005583 + 567 WP_002892030.1 maltose O-acetyltransferase -
QP573_RS19475 (4005555) 4005555..4005695 - 141 WP_004147370.1 hypothetical protein -
QP573_RS19480 (4005716) 4005716..4006186 + 471 WP_020802585.1 YlaC family protein -
QP573_RS19485 (4006161) 4006161..4007612 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
QP573_RS19490 (4007713) 4007713..4008411 + 699 WP_023287311.1 GNAT family protein -
QP573_RS19495 (4008408) 4008408..4008548 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QP573_RS19500 (4008548) 4008548..4008811 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T283460 WP_002892050.1 NZ_CP126987:4004636-4004854 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT283460 WP_002892066.1 NZ_CP126987:4004235-4004609 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References