Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4004235..4004854 | Replicon | chromosome |
| Accession | NZ_CP126987 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain T3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QP573_RS19465 | Protein ID | WP_002892050.1 |
| Coordinates | 4004636..4004854 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | QP573_RS19460 | Protein ID | WP_002892066.1 |
| Coordinates | 4004235..4004609 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP573_RS19450 (3999387) | 3999387..4000580 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QP573_RS19455 (4000603) | 4000603..4003749 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QP573_RS19460 (4004235) | 4004235..4004609 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| QP573_RS19465 (4004636) | 4004636..4004854 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QP573_RS19470 (4005017) | 4005017..4005583 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| QP573_RS19475 (4005555) | 4005555..4005695 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| QP573_RS19480 (4005716) | 4005716..4006186 | + | 471 | WP_020802585.1 | YlaC family protein | - |
| QP573_RS19485 (4006161) | 4006161..4007612 | - | 1452 | WP_004183206.1 | PLP-dependent aminotransferase family protein | - |
| QP573_RS19490 (4007713) | 4007713..4008411 | + | 699 | WP_023287311.1 | GNAT family protein | - |
| QP573_RS19495 (4008408) | 4008408..4008548 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| QP573_RS19500 (4008548) | 4008548..4008811 | - | 264 | WP_032432663.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283460 WP_002892050.1 NZ_CP126987:4004636-4004854 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT283460 WP_002892066.1 NZ_CP126987:4004235-4004609 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |