Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1470745..1471481 | Replicon | chromosome |
| Accession | NZ_CP126987 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain T3 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | QP573_RS07270 | Protein ID | WP_032433360.1 |
| Coordinates | 1470999..1471481 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | QP573_RS07265 | Protein ID | WP_003026799.1 |
| Coordinates | 1470745..1471011 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP573_RS07240 (1466391) | 1466391..1467530 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
| QP573_RS07245 (1467559) | 1467559..1468221 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| QP573_RS07250 (1468202) | 1468202..1469209 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
| QP573_RS07255 (1469227) | 1469227..1469859 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| QP573_RS07260 (1469869) | 1469869..1470432 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| QP573_RS07265 (1470745) | 1470745..1471011 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| QP573_RS07270 (1470999) | 1470999..1471481 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| QP573_RS07275 (1471639) | 1471639..1473171 | - | 1533 | WP_015065592.1 | IS3-like element ISKpn38 family transposase | - |
| QP573_RS07280 (1473283) | 1473283..1474686 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| QP573_RS07285 (1474715) | 1474715..1475347 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| QP573_RS07290 (1475727) | 1475727..1476326 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1438690..1486309 | 47619 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T283454 WP_032433360.1 NZ_CP126987:1470999-1471481 [Klebsiella pneumoniae subsp. pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |