Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1079891..1080808 | Replicon | chromosome |
| Accession | NZ_CP126986 | ||
| Organism | Bacillus velezensis strain MC2S-6 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | I2HQ15 |
| Locus tag | QQF37_RS05545 | Protein ID | WP_007407256.1 |
| Coordinates | 1080062..1080808 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | QQF37_RS05540 | Protein ID | WP_003154807.1 |
| Coordinates | 1079891..1080061 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQF37_RS05500 (QQF37_05500) | 1075124..1076746 | + | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
| QQF37_RS05505 (QQF37_05505) | 1076759..1077130 | + | 372 | WP_032874603.1 | XkdW family protein | - |
| QQF37_RS05510 (QQF37_05510) | 1077135..1077332 | + | 198 | WP_032874605.1 | XkdX family protein | - |
| QQF37_RS05515 (QQF37_05515) | 1077389..1078150 | + | 762 | WP_032874607.1 | hypothetical protein | - |
| QQF37_RS05520 (QQF37_05520) | 1078202..1078465 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
| QQF37_RS05525 (QQF37_05525) | 1078479..1078742 | + | 264 | WP_003154813.1 | phage holin | - |
| QQF37_RS05530 (QQF37_05530) | 1078756..1079634 | + | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QQF37_RS05535 (QQF37_05535) | 1079669..1079794 | - | 126 | WP_003154809.1 | hypothetical protein | - |
| QQF37_RS05540 (QQF37_05540) | 1079891..1080061 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| QQF37_RS05545 (QQF37_05545) | 1080062..1080808 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| QQF37_RS05550 (QQF37_05550) | 1080913..1081911 | - | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
| QQF37_RS05555 (QQF37_05555) | 1081924..1082541 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
| QQF37_RS05560 (QQF37_05560) | 1082827..1084143 | - | 1317 | WP_032874616.1 | amino acid permease | - |
| QQF37_RS05565 (QQF37_05565) | 1084465..1085415 | + | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T283449 WP_007407256.1 NZ_CP126986:c1080808-1080062 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|