Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 328651..329288 | Replicon | chromosome |
| Accession | NZ_CP126986 | ||
| Organism | Bacillus velezensis strain MC2S-6 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | QQF37_RS01560 | Protein ID | WP_003156187.1 |
| Coordinates | 328938..329288 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | QQF37_RS01555 | Protein ID | WP_003156188.1 |
| Coordinates | 328651..328932 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQF37_RS01535 (QQF37_01535) | 325016..325615 | - | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
| QQF37_RS01540 (QQF37_01540) | 325708..326073 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
| QQF37_RS01545 (QQF37_01545) | 326238..327245 | + | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
| QQF37_RS01550 (QQF37_01550) | 327362..328531 | + | 1170 | WP_032873001.1 | alanine racemase | - |
| QQF37_RS01555 (QQF37_01555) | 328651..328932 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| QQF37_RS01560 (QQF37_01560) | 328938..329288 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QQF37_RS01565 (QQF37_01565) | 329406..330227 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| QQF37_RS01570 (QQF37_01570) | 330232..330597 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| QQF37_RS01575 (QQF37_01575) | 330600..331001 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| QQF37_RS01580 (QQF37_01580) | 331013..332020 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| QQF37_RS01585 (QQF37_01585) | 332084..332413 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| QQF37_RS01590 (QQF37_01590) | 332410..332892 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| QQF37_RS01595 (QQF37_01595) | 332858..333646 | + | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
| QQF37_RS01600 (QQF37_01600) | 333646..334248 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T283448 WP_003156187.1 NZ_CP126986:328938-329288 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|