Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-YefM |
Location | 1517304..1517818 | Replicon | chromosome |
Accession | NZ_CP126980 | ||
Organism | Actinoplanes sp. NRRL 3884 |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | Actob_RS07100 | Protein ID | WP_284919258.1 |
Coordinates | 1517304..1517564 (-) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | Actob_RS07105 | Protein ID | WP_284919259.1 |
Coordinates | 1517561..1517818 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
Actob_RS07075 (ACTOB_001415) | 1512950..1513390 | - | 441 | WP_284919253.1 | hypothetical protein | - |
Actob_RS07080 (ACTOB_001416) | 1513813..1514136 | - | 324 | WP_284919254.1 | toxin-antitoxin system HicB family antitoxin | - |
Actob_RS07085 (ACTOB_001417) | 1514139..1514390 | - | 252 | WP_284919255.1 | toxin HicA | - |
Actob_RS07090 (ACTOB_001418) | 1514858..1516087 | + | 1230 | WP_284919256.1 | hypothetical protein | - |
Actob_RS07095 (ACTOB_001419) | 1516145..1517281 | + | 1137 | WP_284919257.1 | hypothetical protein | - |
Actob_RS07100 (ACTOB_001420) | 1517304..1517564 | - | 261 | WP_284919258.1 | Txe/YoeB family addiction module toxin | Toxin |
Actob_RS07105 (ACTOB_001421) | 1517561..1517818 | - | 258 | WP_284919259.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
Actob_RS07110 (ACTOB_001422) | 1518091..1518405 | + | 315 | WP_284919260.1 | hypothetical protein | - |
Actob_RS07115 (ACTOB_001423) | 1518402..1519541 | + | 1140 | WP_284919261.1 | hypothetical protein | - |
Actob_RS07120 (ACTOB_001424) | 1519589..1520239 | + | 651 | WP_284919262.1 | hypothetical protein | - |
Actob_RS07125 (ACTOB_001425) | 1520259..1522397 | - | 2139 | WP_284919263.1 | glycosyl hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1508914..1520239 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10241.56 Da Isoelectric Point: 7.2750
>T283445 WP_284919258.1 NZ_CP126980:c1517564-1517304 [Actinoplanes sp. NRRL 3884]
VKLSWTDHGWDDYLYWQTQDRKTLKRINALIADIKRDPDGQGIGKPEILRNNLAGLRSRRIDDEHRMVYAVEPNEITIIS
CRYHYE
VKLSWTDHGWDDYLYWQTQDRKTLKRINALIADIKRDPDGQGIGKPEILRNNLAGLRSRRIDDEHRMVYAVEPNEITIIS
CRYHYE
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|