Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH |
Location | 1855755..1856433 | Replicon | chromosome |
Accession | NZ_CP126978 | ||
Organism | Gallibacterium anatis strain YJ922 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F4HBW4 |
Locus tag | QP019_RS09060 | Protein ID | WP_013746373.1 |
Coordinates | 1856050..1856433 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QP019_RS09055 | Protein ID | WP_013746372.1 |
Coordinates | 1855755..1856057 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP019_RS09045 (QP019_09045) | 1854191..1854907 | + | 717 | WP_285097078.1 | amino acid ABC transporter permease | - |
QP019_RS09050 (QP019_09050) | 1854910..1855653 | + | 744 | WP_285097079.1 | amino acid ABC transporter ATP-binding protein | - |
QP019_RS09055 (QP019_09055) | 1855755..1856057 | - | 303 | WP_013746372.1 | DNA-binding transcriptional regulator | Antitoxin |
QP019_RS09060 (QP019_09060) | 1856050..1856433 | - | 384 | WP_013746373.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP019_RS09065 (QP019_09065) | 1856715..1857011 | + | 297 | WP_018346511.1 | HigA family addiction module antitoxin | - |
QP019_RS09070 (QP019_09070) | 1857042..1857629 | - | 588 | WP_018346512.1 | Fic family protein | - |
QP019_RS09075 (QP019_09075) | 1857598..1857789 | - | 192 | WP_013746378.1 | antitoxin VbhA family protein | - |
QP019_RS09080 (QP019_09080) | 1858164..1859543 | - | 1380 | WP_285096077.1 | cysteine--tRNA ligase | - |
QP019_RS09085 (QP019_09085) | 1859682..1860194 | + | 513 | WP_013746381.1 | peptidylprolyl isomerase | - |
QP019_RS09090 (QP019_09090) | 1860625..1861236 | + | 612 | WP_285096078.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14213.20 Da Isoelectric Point: 8.9256
>T283444 WP_013746373.1 NZ_CP126978:c1856433-1856050 [Gallibacterium anatis]
MRIFKTKAFNKFALKNGIPDSELINAITRAEQGLIDADLGGNIIKQRIARKGQGRSGGFRSFIFYCIQNNSYFVAGISKN
DRENISSQELAALKALAREYTRLTAKQIEAQIENGLFIEILPEAEDE
MRIFKTKAFNKFALKNGIPDSELINAITRAEQGLIDADLGGNIIKQRIARKGQGRSGGFRSFIFYCIQNNSYFVAGISKN
DRENISSQELAALKALAREYTRLTAKQIEAQIENGLFIEILPEAEDE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|