Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1290995..1291641 | Replicon | chromosome |
Accession | NZ_CP126978 | ||
Organism | Gallibacterium anatis strain YJ922 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QP019_RS06415 | Protein ID | WP_039081346.1 |
Coordinates | 1290995..1291402 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0A2Z0K5 |
Locus tag | QP019_RS06420 | Protein ID | WP_021461268.1 |
Coordinates | 1291402..1291641 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP019_RS06400 (QP019_06400) | 1286701..1288746 | + | 2046 | WP_285097073.1 | methionine--tRNA ligase | - |
QP019_RS06405 (QP019_06405) | 1288827..1289831 | + | 1005 | WP_285095836.1 | 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC | - |
QP019_RS06410 (QP019_06410) | 1290255..1290857 | + | 603 | WP_285095837.1 | transposase | - |
QP019_RS06415 (QP019_06415) | 1290995..1291402 | - | 408 | WP_039081346.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QP019_RS06420 (QP019_06420) | 1291402..1291641 | - | 240 | WP_021461268.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QP019_RS06425 (QP019_06425) | 1291932..1292927 | + | 996 | WP_285095838.1 | thiamine ABC transporter substrate binding subunit | - |
QP019_RS06430 (QP019_06430) | 1292903..1294525 | + | 1623 | WP_285095839.1 | thiamine/thiamine pyrophosphate ABC transporter permease | - |
QP019_RS06435 (QP019_06435) | 1294512..1295174 | + | 663 | WP_021461271.1 | thiamine ABC transporter ATP-binding protein | - |
QP019_RS06440 (QP019_06440) | 1295214..1296224 | + | 1011 | WP_285095840.1 | biotin synthase BioB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15016.54 Da Isoelectric Point: 7.2412
>T283443 WP_039081346.1 NZ_CP126978:c1291402-1290995 [Gallibacterium anatis]
MLKYMLDTNIVIFTIKNKPPHLLPLFNENQSMLCISSITLMELVYGAEKSKKTAQNLAVIESFCARLAVLDYDEAAAYHS
GQIRAELAKIGQPIGPYDAMIAGHARSLGLTVVTNNMNEFSRVEGLRVIDWSKPM
MLKYMLDTNIVIFTIKNKPPHLLPLFNENQSMLCISSITLMELVYGAEKSKKTAQNLAVIESFCARLAVLDYDEAAAYHS
GQIRAELAKIGQPIGPYDAMIAGHARSLGLTVVTNNMNEFSRVEGLRVIDWSKPM
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|