Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-dnstrm_HI1420
Location 164659..165241 Replicon chromosome
Accession NZ_CP126978
Organism Gallibacterium anatis strain YJ922

Toxin (Protein)


Gene name PumA Uniprot ID A0A0A2XQA4
Locus tag QP019_RS00965 Protein ID WP_039087307.1
Coordinates 164659..164955 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QP019_RS00970 Protein ID WP_039087309.1
Coordinates 164957..165241 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP019_RS00925 (QP019_00925) 160166..160690 - 525 WP_285096400.1 hypothetical protein -
QP019_RS00930 (QP019_00930) 160690..160962 - 273 WP_285096401.1 hypothetical protein -
QP019_RS00935 (QP019_00935) 161051..161647 - 597 WP_285096402.1 antA/AntB antirepressor family protein -
QP019_RS00940 (QP019_00940) 162075..162977 + 903 WP_285096403.1 DUF4393 domain-containing protein -
QP019_RS00945 (QP019_00945) 162972..163151 - 180 WP_285096404.1 hypothetical protein -
QP019_RS00950 (QP019_00950) 163185..163343 - 159 WP_285096405.1 hypothetical protein -
QP019_RS00955 (QP019_00955) 163546..163740 + 195 WP_285096406.1 hypothetical protein -
QP019_RS00960 (QP019_00960) 163721..163945 - 225 WP_285096407.1 hypothetical protein -
QP019_RS00965 (QP019_00965) 164659..164955 + 297 WP_039087307.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QP019_RS00970 (QP019_00970) 164957..165241 + 285 WP_039087309.1 putative addiction module antidote protein Antitoxin
QP019_RS00975 (QP019_00975) 165417..165791 - 375 WP_021460879.1 ASCH domain-containing protein -
QP019_RS00980 (QP019_00980) 165763..166812 - 1050 WP_039153689.1 hypothetical protein -
QP019_RS00985 (QP019_00985) 167099..167785 - 687 WP_285096408.1 LexA family transcriptional regulator -
QP019_RS00990 (QP019_00990) 167908..168123 + 216 WP_285096409.1 helix-turn-helix domain-containing protein -
QP019_RS00995 (QP019_00995) 168277..168987 + 711 WP_080737800.1 phage antirepressor KilAC domain-containing protein -
QP019_RS01000 (QP019_01000) 168984..169766 + 783 WP_285096410.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 103046..245631 142585


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(45-90)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 10985.88 Da        Isoelectric Point: 10.3906

>T283441 WP_039087307.1 NZ_CP126978:164659-164955 [Gallibacterium anatis]
MIQIKSTETFDKWLDNLKDLRARAKIQVRIKRLQLGNFGDVKPIGEGLSELRITEGKGYRLYLKNQNGVIVILLCGGDKS
TQKADIEKAKSLAKELGV

Download         Length: 297 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10572.13 Da        Isoelectric Point: 4.8499

>AT283441 WP_039087309.1 NZ_CP126978:164957-165241 [Gallibacterium anatis]
MVEKLHDFDMSEHLRTEEEIQLYLNEILSEGDIDLLLSALGDIAKARNMSQIAREVGITREGLYKALSGRGNPTFATVFK
VMQALNLNLEVKHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A2XQA4

Antitoxin

Source ID Structure

References