Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-dnstrm_HI1420
Location 115716..116298 Replicon chromosome
Accession NZ_CP126978
Organism Gallibacterium anatis strain YJ922

Toxin (Protein)


Gene name PumA Uniprot ID A0A0A2XQA4
Locus tag QP019_RS00590 Protein ID WP_039087307.1
Coordinates 115716..116012 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QP019_RS00595 Protein ID WP_039087309.1
Coordinates 116014..116298 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP019_RS00550 (QP019_00550) 111223..111747 - 525 WP_285096400.1 hypothetical protein -
QP019_RS00555 (QP019_00555) 111747..112019 - 273 WP_285096401.1 hypothetical protein -
QP019_RS00560 (QP019_00560) 112108..112704 - 597 WP_285096402.1 antA/AntB antirepressor family protein -
QP019_RS00565 (QP019_00565) 113132..114034 + 903 WP_285096403.1 DUF4393 domain-containing protein -
QP019_RS00570 (QP019_00570) 114029..114208 - 180 WP_285096404.1 hypothetical protein -
QP019_RS00575 (QP019_00575) 114242..114400 - 159 WP_285096405.1 hypothetical protein -
QP019_RS00580 (QP019_00580) 114603..114797 + 195 WP_285096406.1 hypothetical protein -
QP019_RS00585 (QP019_00585) 114778..115002 - 225 WP_285096407.1 hypothetical protein -
QP019_RS00590 (QP019_00590) 115716..116012 + 297 WP_039087307.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QP019_RS00595 (QP019_00595) 116014..116298 + 285 WP_039087309.1 putative addiction module antidote protein Antitoxin
QP019_RS00600 (QP019_00600) 116474..116848 - 375 WP_021460879.1 ASCH domain-containing protein -
QP019_RS00605 (QP019_00605) 116820..117869 - 1050 WP_039153689.1 hypothetical protein -
QP019_RS00610 (QP019_00610) 118156..118842 - 687 WP_285096408.1 LexA family transcriptional regulator -
QP019_RS00615 (QP019_00615) 118965..119180 + 216 WP_285096409.1 helix-turn-helix domain-containing protein -
QP019_RS00620 (QP019_00620) 119334..120044 + 711 WP_080737800.1 phage antirepressor KilAC domain-containing protein -
QP019_RS00625 (QP019_00625) 120041..120823 + 783 WP_285096410.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 103046..245631 142585


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(45-90)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 10985.88 Da        Isoelectric Point: 10.3906

>T283439 WP_039087307.1 NZ_CP126978:115716-116012 [Gallibacterium anatis]
MIQIKSTETFDKWLDNLKDLRARAKIQVRIKRLQLGNFGDVKPIGEGLSELRITEGKGYRLYLKNQNGVIVILLCGGDKS
TQKADIEKAKSLAKELGV

Download         Length: 297 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10572.13 Da        Isoelectric Point: 4.8499

>AT283439 WP_039087309.1 NZ_CP126978:116014-116298 [Gallibacterium anatis]
MVEKLHDFDMSEHLRTEEEIQLYLNEILSEGDIDLLLSALGDIAKARNMSQIAREVGITREGLYKALSGRGNPTFATVFK
VMQALNLNLEVKHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A2XQA4

Antitoxin

Source ID Structure

References