Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1813374..1813991 | Replicon | chromosome |
Accession | NZ_CP126977 | ||
Organism | Gallibacterium anatis strain DFSO2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A2Y920 |
Locus tag | QP020_RS08650 | Protein ID | WP_039133250.1 |
Coordinates | 1813809..1813991 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | F4HBU2 |
Locus tag | QP020_RS08645 | Protein ID | WP_013746351.1 |
Coordinates | 1813374..1813781 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP020_RS08630 (QP020_08630) | 1810140..1810835 | + | 696 | WP_285097754.1 | hypothetical protein | - |
QP020_RS08635 (QP020_08635) | 1811016..1811606 | - | 591 | WP_285097755.1 | uracil-DNA glycosylase family protein | - |
QP020_RS08640 (QP020_08640) | 1811682..1812794 | - | 1113 | WP_039087924.1 | aspartate-semialdehyde dehydrogenase | - |
QP020_RS08645 (QP020_08645) | 1813374..1813781 | - | 408 | WP_013746351.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QP020_RS08650 (QP020_08650) | 1813809..1813991 | - | 183 | WP_039133250.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6830.10 Da Isoelectric Point: 10.8973
>T283438 WP_039133250.1 NZ_CP126977:c1813991-1813809 [Gallibacterium anatis]
VDSKTLIKMLEKDGWYLVNVVGSHHQFKHPIKKGRTTVPHPKKDLQIKTVNSILKQAGLK
VDSKTLIKMLEKDGWYLVNVVGSHHQFKHPIKKGRTTVPHPKKDLQIKTVNSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14869.04 Da Isoelectric Point: 4.4474
>AT283438 WP_013746351.1 NZ_CP126977:c1813781-1813374 [Gallibacterium anatis]
MLYPIGIEMGDDKHAFGVIVPDVPGCFSAGDTLEEAYINAKEAIAFHIEGMLEDGEEFPLPTDIKAHMNNKEFEGFTFTF
VDVDLSHLMGKAEKINITLPALLLHKIDAFIATHPEYKSRSGFLAQLATDKLLSA
MLYPIGIEMGDDKHAFGVIVPDVPGCFSAGDTLEEAYINAKEAIAFHIEGMLEDGEEFPLPTDIKAHMNNKEFEGFTFTF
VDVDLSHLMGKAEKINITLPALLLHKIDAFIATHPEYKSRSGFLAQLATDKLLSA
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2Y920 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | F4HBU2 |