Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1261351..1261997 | Replicon | chromosome |
Accession | NZ_CP126977 | ||
Organism | Gallibacterium anatis strain DFSO2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QP020_RS05960 | Protein ID | WP_285099324.1 |
Coordinates | 1261351..1261758 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0A2Z0K5 |
Locus tag | QP020_RS05965 | Protein ID | WP_021461268.1 |
Coordinates | 1261758..1261997 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP020_RS05940 (QP020_05940) | 1256360..1256605 | + | 246 | WP_285099322.1 | hypothetical protein | - |
QP020_RS05945 (QP020_05945) | 1256800..1257918 | - | 1119 | WP_285099323.1 | iron-sulfur cluster carrier protein ApbC | - |
QP020_RS05950 (QP020_05950) | 1258117..1260162 | + | 2046 | WP_285099408.1 | methionine--tRNA ligase | - |
QP020_RS05955 (QP020_05955) | 1260247..1261251 | + | 1005 | WP_039093699.1 | 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC | - |
QP020_RS05960 (QP020_05960) | 1261351..1261758 | - | 408 | WP_285099324.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QP020_RS05965 (QP020_05965) | 1261758..1261997 | - | 240 | WP_021461268.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QP020_RS05970 (QP020_05970) | 1262288..1263283 | + | 996 | WP_285099326.1 | thiamine ABC transporter substrate binding subunit | - |
QP020_RS05975 (QP020_05975) | 1263259..1264881 | + | 1623 | WP_285099328.1 | thiamine/thiamine pyrophosphate ABC transporter permease | - |
QP020_RS05980 (QP020_05980) | 1264868..1265530 | + | 663 | WP_039085662.1 | thiamine ABC transporter ATP-binding protein | - |
QP020_RS05985 (QP020_05985) | 1265570..1266580 | + | 1011 | WP_210640912.1 | biotin synthase BioB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15006.50 Da Isoelectric Point: 7.2412
>T283437 WP_285099324.1 NZ_CP126977:c1261758-1261351 [Gallibacterium anatis]
MLKYMLDTNIVIFTIKNKPPHLLPLFNENQSMLCISSITLMELVYGAEKSKKTAQNLAVIESFCARLAVLDYDEAAAYHS
GQIRAELAKIGQPIGSYDAMIAGHARSLGLTVVTNNMNEFSRVEGLRVIDWSKPM
MLKYMLDTNIVIFTIKNKPPHLLPLFNENQSMLCISSITLMELVYGAEKSKKTAQNLAVIESFCARLAVLDYDEAAAYHS
GQIRAELAKIGQPIGSYDAMIAGHARSLGLTVVTNNMNEFSRVEGLRVIDWSKPM
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|