Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1208431..1208976 | Replicon | chromosome |
| Accession | NZ_CP126977 | ||
| Organism | Gallibacterium anatis strain DFSO2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F4HF99 |
| Locus tag | QP020_RS05705 | Protein ID | WP_013746939.1 |
| Coordinates | 1208431..1208718 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0A2ZZB6 |
| Locus tag | QP020_RS05710 | Protein ID | WP_039087491.1 |
| Coordinates | 1208728..1208976 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP020_RS05675 (QP020_05675) | 1203707..1204633 | + | 927 | WP_285099268.1 | phosphoserine phosphatase | - |
| QP020_RS05680 (QP020_05680) | 1204646..1205137 | + | 492 | WP_039087484.1 | YajQ family cyclic di-GMP-binding protein | - |
| QP020_RS05685 (QP020_05685) | 1205159..1205326 | + | 168 | WP_013746943.1 | DUF5363 family protein | - |
| QP020_RS05690 (QP020_05690) | 1205411..1207426 | + | 2016 | WP_285099269.1 | NAD-dependent DNA ligase LigA | - |
| QP020_RS05695 (QP020_05695) | 1207628..1207894 | + | 267 | WP_039087486.1 | antitoxin MazE | - |
| QP020_RS05700 (QP020_05700) | 1207894..1208247 | + | 354 | WP_285099273.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QP020_RS05705 (QP020_05705) | 1208431..1208718 | - | 288 | WP_013746939.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QP020_RS05710 (QP020_05710) | 1208728..1208976 | - | 249 | WP_039087491.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QP020_RS05715 (QP020_05715) | 1209093..1210145 | - | 1053 | WP_285099276.1 | porin | - |
| QP020_RS05720 (QP020_05720) | 1210910..1211971 | + | 1062 | WP_285099277.1 | porin | - |
| QP020_RS05725 (QP020_05725) | 1212285..1213367 | - | 1083 | WP_285099279.1 | porin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11026.94 Da Isoelectric Point: 10.4262
>T283436 WP_013746939.1 NZ_CP126977:c1208718-1208431 [Gallibacterium anatis]
MAYAIKVHSDFVAELNKLDSTIKNQLRKKLEKVVHNPHIPKNRLSGELHNCYKIKLRKAGVRLVYQVNDDEIYILLLTVG
KREAKQVYNTALNRV
MAYAIKVHSDFVAELNKLDSTIKNQLRKKLEKVVHNPHIPKNRLSGELHNCYKIKLRKAGVRLVYQVNDDEIYILLLTVG
KREAKQVYNTALNRV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | F4HF99 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A2ZZB6 |