Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH |
| Location | 2068956..2069634 | Replicon | chromosome |
| Accession | NZ_CP126975 | ||
| Organism | Gallibacterium anatis strain BJF12 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0A3AQ60 |
| Locus tag | QP018_RS09865 | Protein ID | WP_039139159.1 |
| Coordinates | 2069251..2069634 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QP018_RS09860 | Protein ID | WP_013746372.1 |
| Coordinates | 2068956..2069258 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP018_RS09835 (QP018_09835) | 2064277..2064996 | + | 720 | WP_210641021.1 | DUF969 domain-containing protein | - |
| QP018_RS09840 (QP018_09840) | 2064996..2065979 | + | 984 | WP_285090755.1 | DUF979 domain-containing protein | - |
| QP018_RS09845 (QP018_09845) | 2065989..2066981 | + | 993 | WP_285090756.1 | DUF2891 domain-containing protein | - |
| QP018_RS09850 (QP018_09850) | 2067392..2068108 | + | 717 | WP_031205117.1 | amino acid ABC transporter permease | - |
| QP018_RS09855 (QP018_09855) | 2068111..2068854 | + | 744 | WP_285090786.1 | amino acid ABC transporter ATP-binding protein | - |
| QP018_RS09860 (QP018_09860) | 2068956..2069258 | - | 303 | WP_013746372.1 | DNA-binding transcriptional regulator | Antitoxin |
| QP018_RS09865 (QP018_09865) | 2069251..2069634 | - | 384 | WP_039139159.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QP018_RS09870 (QP018_09870) | 2069916..2070212 | + | 297 | WP_018346511.1 | HigA family addiction module antitoxin | - |
| QP018_RS09875 (QP018_09875) | 2070243..2070830 | - | 588 | WP_210641902.1 | Fic family protein | - |
| QP018_RS09880 (QP018_09880) | 2070799..2070990 | - | 192 | WP_013746378.1 | antitoxin VbhA family protein | - |
| QP018_RS09885 (QP018_09885) | 2071756..2073135 | - | 1380 | WP_285090757.1 | cysteine--tRNA ligase | - |
| QP018_RS09890 (QP018_09890) | 2073274..2073786 | + | 513 | WP_013746381.1 | peptidylprolyl isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14241.26 Da Isoelectric Point: 8.9256
>T283434 WP_039139159.1 NZ_CP126975:c2069634-2069251 [Gallibacterium anatis]
MRIFKTKAFNKFALKNGIPDSELINAITRVEQGLIDADLGGNIIKQRIARKGQGRSGGFRSFIFYCIQNNSYFVAGISKN
DRENISSQELAALKALAREYTRLTAKQIEAQIENGLFIEILPEAEDE
MRIFKTKAFNKFALKNGIPDSELINAITRVEQGLIDADLGGNIIKQRIARKGQGRSGGFRSFIFYCIQNNSYFVAGISKN
DRENISSQELAALKALAREYTRLTAKQIEAQIENGLFIEILPEAEDE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|