Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2033280..2033897 | Replicon | chromosome |
Accession | NZ_CP126975 | ||
Organism | Gallibacterium anatis strain BJF12 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A2Y920 |
Locus tag | QP018_RS09770 | Protein ID | WP_039133250.1 |
Coordinates | 2033715..2033897 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | F4HBU2 |
Locus tag | QP018_RS09765 | Protein ID | WP_013746351.1 |
Coordinates | 2033280..2033687 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP018_RS09740 (QP018_09740) | 2028850..2029524 | - | 675 | WP_285090783.1 | hypothetical protein | - |
QP018_RS09745 (QP018_09745) | 2029719..2030138 | + | 420 | WP_021461944.1 | helix-turn-helix domain-containing protein | - |
QP018_RS09750 (QP018_09750) | 2030622..2030804 | + | 183 | WP_013746348.1 | glycine zipper 2TM domain-containing protein | - |
QP018_RS09755 (QP018_09755) | 2030920..2031510 | - | 591 | WP_285090749.1 | uracil-DNA glycosylase family protein | - |
QP018_RS09760 (QP018_09760) | 2031588..2032700 | - | 1113 | WP_285090750.1 | aspartate-semialdehyde dehydrogenase | - |
QP018_RS09765 (QP018_09765) | 2033280..2033687 | - | 408 | WP_013746351.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QP018_RS09770 (QP018_09770) | 2033715..2033897 | - | 183 | WP_039133250.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6830.10 Da Isoelectric Point: 10.8973
>T283433 WP_039133250.1 NZ_CP126975:c2033897-2033715 [Gallibacterium anatis]
VDSKTLIKMLEKDGWYLVNVVGSHHQFKHPIKKGRTTVPHPKKDLQIKTVNSILKQAGLK
VDSKTLIKMLEKDGWYLVNVVGSHHQFKHPIKKGRTTVPHPKKDLQIKTVNSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14869.04 Da Isoelectric Point: 4.4474
>AT283433 WP_013746351.1 NZ_CP126975:c2033687-2033280 [Gallibacterium anatis]
MLYPIGIEMGDDKHAFGVIVPDVPGCFSAGDTLEEAYINAKEAIAFHIEGMLEDGEEFPLPTDIKAHMNNKEFEGFTFTF
VDVDLSHLMGKAEKINITLPALLLHKIDAFIATHPEYKSRSGFLAQLATDKLLSA
MLYPIGIEMGDDKHAFGVIVPDVPGCFSAGDTLEEAYINAKEAIAFHIEGMLEDGEEFPLPTDIKAHMNNKEFEGFTFTF
VDVDLSHLMGKAEKINITLPALLLHKIDAFIATHPEYKSRSGFLAQLATDKLLSA
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2Y920 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | F4HBU2 |