Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1410262..1410885 | Replicon | chromosome |
Accession | NZ_CP126975 | ||
Organism | Gallibacterium anatis strain BJF12 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F4HF99 |
Locus tag | QP018_RS06745 | Protein ID | WP_013746939.1 |
Coordinates | 1410262..1410549 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QP018_RS06750 | Protein ID | WP_285097391.1 |
Coordinates | 1410559..1410885 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP018_RS06715 (QP018_06715) | 1405539..1406465 | + | 927 | WP_285092650.1 | phosphoserine phosphatase | - |
QP018_RS06720 (QP018_06720) | 1406478..1406969 | + | 492 | WP_285092649.1 | YajQ family cyclic di-GMP-binding protein | - |
QP018_RS06725 (QP018_06725) | 1406991..1407158 | + | 168 | WP_018345760.1 | DUF5363 family protein | - |
QP018_RS06730 (QP018_06730) | 1407243..1409258 | + | 2016 | WP_052115960.1 | NAD-dependent DNA ligase LigA | - |
QP018_RS06735 (QP018_06735) | 1409461..1409727 | + | 267 | WP_039135859.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
QP018_RS06740 (QP018_06740) | 1409727..1410080 | + | 354 | WP_039135860.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
QP018_RS06745 (QP018_06745) | 1410262..1410549 | - | 288 | WP_013746939.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QP018_RS06750 (QP018_06750) | 1410559..1410885 | - | 327 | WP_285097391.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QP018_RS06755 (QP018_06755) | 1410984..1411244 | - | 261 | WP_080735137.1 | DUF1778 domain-containing protein | - |
QP018_RS06760 (QP018_06760) | 1411386..1412489 | - | 1104 | WP_285092647.1 | porin | - |
QP018_RS06765 (QP018_06765) | 1413256..1414311 | + | 1056 | WP_285092818.1 | porin | - |
QP018_RS06770 (QP018_06770) | 1414617..1415693 | - | 1077 | WP_285092819.1 | porin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11026.94 Da Isoelectric Point: 10.4262
>T283432 WP_013746939.1 NZ_CP126975:c1410549-1410262 [Gallibacterium anatis]
MAYAIKVHSDFVAELNKLDSTIKNQLRKKLEKVVHNPHIPKNRLSGELHNCYKIKLRKAGVRLVYQVNDDEIYILLLTVG
KREAKQVYNTALNRV
MAYAIKVHSDFVAELNKLDSTIKNQLRKKLEKVVHNPHIPKNRLSGELHNCYKIKLRKAGVRLVYQVNDDEIYILLLTVG
KREAKQVYNTALNRV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|