Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5183166..5183791 | Replicon | chromosome |
| Accession | NZ_CP126974 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain 111-2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | QPX97_RS24980 | Protein ID | WP_002882817.1 |
| Coordinates | 5183166..5183549 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | QPX97_RS24985 | Protein ID | WP_004150355.1 |
| Coordinates | 5183549..5183791 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPX97_RS24965 (QPX97_24965) | 5180532..5181434 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| QPX97_RS24970 (QPX97_24970) | 5181431..5182066 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QPX97_RS24975 (QPX97_24975) | 5182063..5182992 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| QPX97_RS24980 (QPX97_24980) | 5183166..5183549 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QPX97_RS24985 (QPX97_24985) | 5183549..5183791 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| QPX97_RS24990 (QPX97_24990) | 5183996..5184913 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| QPX97_RS24995 (QPX97_24995) | 5184927..5185868 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| QPX97_RS25000 (QPX97_25000) | 5185913..5186350 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| QPX97_RS25005 (QPX97_25005) | 5186347..5187207 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| QPX97_RS25010 (QPX97_25010) | 5187201..5187800 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T283429 WP_002882817.1 NZ_CP126974:c5183549-5183166 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |