Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4702878..4703394 | Replicon | chromosome |
| Accession | NZ_CP126974 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain 111-2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | QPX97_RS22680 | Protein ID | WP_004178374.1 |
| Coordinates | 4702878..4703162 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | QPX97_RS22685 | Protein ID | WP_002886901.1 |
| Coordinates | 4703152..4703394 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPX97_RS22655 (QPX97_22655) | 4698274..4698537 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| QPX97_RS22660 (QPX97_22660) | 4698667..4698840 | + | 174 | WP_004222159.1 | hypothetical protein | - |
| QPX97_RS22665 (QPX97_22665) | 4698843..4699586 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| QPX97_RS22670 (QPX97_22670) | 4699943..4702081 | + | 2139 | WP_032415880.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QPX97_RS22675 (QPX97_22675) | 4702410..4702874 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QPX97_RS22680 (QPX97_22680) | 4702878..4703162 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QPX97_RS22685 (QPX97_22685) | 4703152..4703394 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QPX97_RS22690 (QPX97_22690) | 4703472..4705382 | - | 1911 | WP_130974884.1 | PRD domain-containing protein | - |
| QPX97_RS22695 (QPX97_22695) | 4705405..4706559 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| QPX97_RS22700 (QPX97_22700) | 4706626..4707366 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T283427 WP_004178374.1 NZ_CP126974:c4703162-4702878 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |