Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3983023..3983642 Replicon chromosome
Accession NZ_CP126974
Organism Klebsiella pneumoniae subsp. pneumoniae strain 111-2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QPX97_RS19300 Protein ID WP_002892050.1
Coordinates 3983424..3983642 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QPX97_RS19295 Protein ID WP_002892066.1
Coordinates 3983023..3983397 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPX97_RS19285 (QPX97_19285) 3978175..3979368 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QPX97_RS19290 (QPX97_19290) 3979391..3982537 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QPX97_RS19295 (QPX97_19295) 3983023..3983397 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QPX97_RS19300 (QPX97_19300) 3983424..3983642 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QPX97_RS19305 (QPX97_19305) 3983801..3984367 + 567 WP_002892030.1 maltose O-acetyltransferase -
QPX97_RS19310 (QPX97_19310) 3984339..3984479 - 141 WP_004147370.1 hypothetical protein -
QPX97_RS19315 (QPX97_19315) 3984500..3984970 + 471 WP_002892026.1 YlaC family protein -
QPX97_RS19320 (QPX97_19320) 3984945..3986396 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QPX97_RS19325 (QPX97_19325) 3986497..3987195 + 699 WP_032414604.1 GNAT family protein -
QPX97_RS19330 (QPX97_19330) 3987192..3987332 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QPX97_RS19335 (QPX97_19335) 3987332..3987595 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T283425 WP_002892050.1 NZ_CP126974:3983424-3983642 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT283425 WP_002892066.1 NZ_CP126974:3983023-3983397 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References