Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 194386..195125 | Replicon | chromosome |
| Accession | NZ_CP126974 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain 111-2 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | QPX97_RS00955 | Protein ID | WP_021312536.1 |
| Coordinates | 194640..195125 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | QPX97_RS00950 | Protein ID | WP_003026799.1 |
| Coordinates | 194386..194652 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QPX97_RS00935 (QPX97_00935) | 189889..191958 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
| QPX97_RS00940 (QPX97_00940) | 192255..193624 | + | 1370 | WP_087830479.1 | IS3 family transposase | - |
| QPX97_RS00945 (QPX97_00945) | 193825..194253 | + | 429 | WP_004901287.1 | GFA family protein | - |
| QPX97_RS00950 (QPX97_00950) | 194386..194652 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| QPX97_RS00955 (QPX97_00955) | 194640..195125 | + | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
| QPX97_RS00960 (QPX97_00960) | 195469..195621 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| QPX97_RS00965 (QPX97_00965) | 195923..197542 | + | 1620 | WP_032415799.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| QPX97_RS00970 (QPX97_00970) | 197641..197853 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| QPX97_RS00975 (QPX97_00975) | 198106..198396 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| QPX97_RS00980 (QPX97_00980) | 198642..199997 | - | 1356 | WP_032415797.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 192899..193624 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T283416 WP_021312536.1 NZ_CP126974:194640-195125 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|