Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2243920..2244582 | Replicon | chromosome |
| Accession | NZ_CP126962 | ||
| Organism | Globicatella sanguinis strain UMB0514 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | CYJ72_RS09925 | Protein ID | WP_066124893.1 |
| Coordinates | 2243920..2244120 (+) | Length | 67 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | CYJ72_RS09930 | Protein ID | WP_284629729.1 |
| Coordinates | 2244136..2244582 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CYJ72_RS09895 (CYJ72_009895) | 2239522..2240697 | + | 1176 | WP_284629723.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| CYJ72_RS09900 (CYJ72_009900) | 2240694..2241128 | + | 435 | WP_284629724.1 | PTS sugar transporter subunit IIA | - |
| CYJ72_RS09905 (CYJ72_009905) | 2241128..2241412 | + | 285 | WP_284629725.1 | preprotein translocase subunit YajC | - |
| CYJ72_RS09910 (CYJ72_009910) | 2241448..2241924 | + | 477 | WP_284629726.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| CYJ72_RS09915 (CYJ72_009915) | 2241939..2242751 | + | 813 | WP_284629727.1 | PTS sugar transporter subunit IIC | - |
| CYJ72_RS09920 (CYJ72_009920) | 2242741..2243763 | + | 1023 | WP_284629728.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| CYJ72_RS09925 (CYJ72_009925) | 2243920..2244120 | + | 201 | WP_066124893.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| CYJ72_RS09930 (CYJ72_009930) | 2244136..2244582 | + | 447 | WP_284629729.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| CYJ72_RS09935 (CYJ72_009935) | 2245040..2246146 | - | 1107 | WP_284629730.1 | alanine dehydrogenase | - |
| CYJ72_RS09940 (CYJ72_009940) | 2247025..2247249 | + | 225 | WP_066124577.1 | helix-turn-helix transcriptional regulator | - |
| CYJ72_RS09945 (CYJ72_009945) | 2247263..2247742 | + | 480 | WP_284629731.1 | sigma-70 family RNA polymerase sigma factor | - |
| CYJ72_RS09950 (CYJ72_009950) | 2248209..2248409 | + | 201 | WP_066124581.1 | hypothetical protein | - |
| CYJ72_RS09955 (CYJ72_009955) | 2248423..2248674 | + | 252 | WP_066124583.1 | DUF2922 domain-containing protein | - |
| CYJ72_RS09960 (CYJ72_009960) | 2248739..2248981 | + | 243 | WP_066124586.1 | hypothetical protein | - |
| CYJ72_RS09965 (CYJ72_009965) | 2248971..2249207 | + | 237 | WP_066124588.1 | phage holin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 67 a.a. Molecular weight: 7711.32 Da Isoelectric Point: 11.0180
>T283408 WP_066124893.1 NZ_CP126962:2243920-2244120 [Globicatella sanguinis]
MPLTQLEMMKLLMLHGWTPYTREGKGSHIKMKKKGCRPIIIPHGELKRGTERNILKQANLLALWHH
MPLTQLEMMKLLMLHGWTPYTREGKGSHIKMKKKGCRPIIIPHGELKRGTERNILKQANLLALWHH
Download Length: 201 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16997.14 Da Isoelectric Point: 3.9732
>AT283408 WP_284629729.1 NZ_CP126962:2244136-2244582 [Globicatella sanguinis]
MQVVYPALFYFDPKESNYFITFPDFEYSATQGENLADAMMMAAEYLGIQVADLIEENHTLPIPTNINELSLIEHNPFRED
SEFSQDYDEQQSFISMVTTDVTRYLGMQELVKKTLTIPKWADIAGKELQLNFSQTLTEAILAKKFESS
MQVVYPALFYFDPKESNYFITFPDFEYSATQGENLADAMMMAAEYLGIQVADLIEENHTLPIPTNINELSLIEHNPFRED
SEFSQDYDEQQSFISMVTTDVTRYLGMQELVKKTLTIPKWADIAGKELQLNFSQTLTEAILAKKFESS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|