Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2243920..2244582 Replicon chromosome
Accession NZ_CP126962
Organism Globicatella sanguinis strain UMB0514

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag CYJ72_RS09925 Protein ID WP_066124893.1
Coordinates 2243920..2244120 (+) Length 67 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag CYJ72_RS09930 Protein ID WP_284629729.1
Coordinates 2244136..2244582 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CYJ72_RS09895 (CYJ72_009895) 2239522..2240697 + 1176 WP_284629723.1 N-acetylglucosamine-6-phosphate deacetylase -
CYJ72_RS09900 (CYJ72_009900) 2240694..2241128 + 435 WP_284629724.1 PTS sugar transporter subunit IIA -
CYJ72_RS09905 (CYJ72_009905) 2241128..2241412 + 285 WP_284629725.1 preprotein translocase subunit YajC -
CYJ72_RS09910 (CYJ72_009910) 2241448..2241924 + 477 WP_284629726.1 PTS N-acetylgalactosamine transporter subunit IIB -
CYJ72_RS09915 (CYJ72_009915) 2241939..2242751 + 813 WP_284629727.1 PTS sugar transporter subunit IIC -
CYJ72_RS09920 (CYJ72_009920) 2242741..2243763 + 1023 WP_284629728.1 PTS system mannose/fructose/sorbose family transporter subunit IID -
CYJ72_RS09925 (CYJ72_009925) 2243920..2244120 + 201 WP_066124893.1 type II toxin-antitoxin system HicA family toxin Toxin
CYJ72_RS09930 (CYJ72_009930) 2244136..2244582 + 447 WP_284629729.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
CYJ72_RS09935 (CYJ72_009935) 2245040..2246146 - 1107 WP_284629730.1 alanine dehydrogenase -
CYJ72_RS09940 (CYJ72_009940) 2247025..2247249 + 225 WP_066124577.1 helix-turn-helix transcriptional regulator -
CYJ72_RS09945 (CYJ72_009945) 2247263..2247742 + 480 WP_284629731.1 sigma-70 family RNA polymerase sigma factor -
CYJ72_RS09950 (CYJ72_009950) 2248209..2248409 + 201 WP_066124581.1 hypothetical protein -
CYJ72_RS09955 (CYJ72_009955) 2248423..2248674 + 252 WP_066124583.1 DUF2922 domain-containing protein -
CYJ72_RS09960 (CYJ72_009960) 2248739..2248981 + 243 WP_066124586.1 hypothetical protein -
CYJ72_RS09965 (CYJ72_009965) 2248971..2249207 + 237 WP_066124588.1 phage holin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(7-60)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-70)


Sequences

Toxin        


Download         Length: 67 a.a.        Molecular weight: 7711.32 Da        Isoelectric Point: 11.0180

>T283408 WP_066124893.1 NZ_CP126962:2243920-2244120 [Globicatella sanguinis]
MPLTQLEMMKLLMLHGWTPYTREGKGSHIKMKKKGCRPIIIPHGELKRGTERNILKQANLLALWHH

Download         Length: 201 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16997.14 Da        Isoelectric Point: 3.9732

>AT283408 WP_284629729.1 NZ_CP126962:2244136-2244582 [Globicatella sanguinis]
MQVVYPALFYFDPKESNYFITFPDFEYSATQGENLADAMMMAAEYLGIQVADLIEENHTLPIPTNINELSLIEHNPFRED
SEFSQDYDEQQSFISMVTTDVTRYLGMQELVKKTLTIPKWADIAGKELQLNFSQTLTEAILAKKFESS

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References