Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 1168584..1169158 | Replicon | chromosome |
Accession | NZ_CP126962 | ||
Organism | Globicatella sanguinis strain UMB0514 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2I1PHX1 |
Locus tag | CYJ72_RS05055 | Protein ID | WP_066124768.1 |
Coordinates | 1168584..1168928 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2I1PHY3 |
Locus tag | CYJ72_RS05060 | Protein ID | WP_066124770.1 |
Coordinates | 1168928..1169158 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CYJ72_RS05040 (CYJ72_005040) | 1164764..1165984 | - | 1221 | WP_284630818.1 | ATP-binding protein | - |
CYJ72_RS05045 (CYJ72_005045) | 1166140..1167231 | - | 1092 | WP_066124764.1 | alpha/beta fold hydrolase | - |
CYJ72_RS05050 (CYJ72_005050) | 1167317..1168168 | - | 852 | WP_284630819.1 | hypothetical protein | - |
CYJ72_RS05055 (CYJ72_005055) | 1168584..1168928 | - | 345 | WP_066124768.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CYJ72_RS05060 (CYJ72_005060) | 1168928..1169158 | - | 231 | WP_066124770.1 | hypothetical protein | Antitoxin |
CYJ72_RS05065 (CYJ72_005065) | 1169536..1170405 | - | 870 | WP_066124772.1 | carbohydrate ABC transporter permease | - |
CYJ72_RS05070 (CYJ72_005070) | 1170405..1171331 | - | 927 | WP_066124774.1 | sugar ABC transporter permease | - |
CYJ72_RS05075 (CYJ72_005075) | 1171554..1172837 | - | 1284 | WP_066124777.1 | ABC transporter substrate-binding protein | - |
CYJ72_RS05080 (CYJ72_005080) | 1173255..1173719 | + | 465 | WP_284630820.1 | hypothetical protein | - |
CYJ72_RS05085 (CYJ72_005085) | 1173918..1174109 | - | 192 | WP_101813291.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13224.30 Da Isoelectric Point: 9.4828
>T283407 WP_066124768.1 NZ_CP126962:c1168928-1168584 [Globicatella sanguinis]
MLEVNSYVPSKGDIVWFDFDPSAGKEIQKRRPALVVSRHDFNRTTGFAIVCPITTTQLNYPTRVQLPHMIKTKGQIVIPQ
LKSLDFNSRQVEFIEKLPEGYIQRVDQIIQYIFN
MLEVNSYVPSKGDIVWFDFDPSAGKEIQKRRPALVVSRHDFNRTTGFAIVCPITTTQLNYPTRVQLPHMIKTKGQIVIPQ
LKSLDFNSRQVEFIEKLPEGYIQRVDQIIQYIFN
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I1PHX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I1PHY3 |