Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 1844165..1844718 | Replicon | chromosome |
Accession | NZ_CP126958 | ||
Organism | Aerococcus sp. UMB0080 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2I1L771 |
Locus tag | CJ190_RS08375 | Protein ID | WP_070598393.1 |
Coordinates | 1844440..1844718 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2I1L768 |
Locus tag | CJ190_RS08370 | Protein ID | WP_070598390.1 |
Coordinates | 1844165..1844440 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJ190_RS08350 (CJ190_008350) | 1841220..1842347 | + | 1128 | WP_070598382.1 | restriction endonuclease subunit S | - |
CJ190_RS08355 (CJ190_008355) | 1842399..1842653 | - | 255 | WP_070598384.1 | Txe/YoeB family addiction module toxin | - |
CJ190_RS08360 (CJ190_008360) | 1842653..1842898 | - | 246 | WP_070598386.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
CJ190_RS08365 (CJ190_008365) | 1842953..1843873 | - | 921 | WP_070598388.1 | site-specific integrase | - |
CJ190_RS08370 (CJ190_008370) | 1844165..1844440 | + | 276 | WP_070598390.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
CJ190_RS08375 (CJ190_008375) | 1844440..1844718 | + | 279 | WP_070598393.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
CJ190_RS08380 (CJ190_008380) | 1844958..1845578 | - | 621 | WP_070598395.1 | restriction endonuclease subunit S | - |
CJ190_RS08385 (CJ190_008385) | 1845578..1846489 | - | 912 | Protein_1600 | type I restriction-modification system subunit M | - |
CJ190_RS08390 (CJ190_008390) | 1846566..1848059 | - | 1494 | WP_101562046.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | erm(A) | - | 1803030..1940282 | 137252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10947.78 Da Isoelectric Point: 9.3100
>T283404 WP_070598393.1 NZ_CP126958:1844440-1844718 [Aerococcus sp. UMB0080]
MYKVKFTNAYKKSYKRMFKRGVDLSLLDEVVDNLRRGIQLDPRYKNHMLKGKFSGYFECHIKPDWLLIYLIEDDILTLTL
IDTGSHSDLFNL
MYKVKFTNAYKKSYKRMFKRGVDLSLLDEVVDNLRRGIQLDPRYKNHMLKGKFSGYFECHIKPDWLLIYLIEDDILTLTL
IDTGSHSDLFNL
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I1L771 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I1L768 |