Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1221271..1221842 | Replicon | chromosome |
Accession | NZ_CP126958 | ||
Organism | Aerococcus sp. UMB0080 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A178HCX2 |
Locus tag | CJ190_RS05530 | Protein ID | WP_064293476.1 |
Coordinates | 1221510..1221842 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A178HDW3 |
Locus tag | CJ190_RS05525 | Protein ID | WP_064293475.1 |
Coordinates | 1221271..1221516 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CJ190_RS05505 (CJ190_005505) | 1216744..1216956 | - | 213 | WP_064293066.1 | hypothetical protein | - |
CJ190_RS05510 (CJ190_005510) | 1217382..1218329 | - | 948 | WP_064293064.1 | HEPN domain-containing protein | - |
CJ190_RS05515 (CJ190_005515) | 1218552..1219211 | - | 660 | WP_101562114.1 | hypothetical protein | - |
CJ190_RS05520 (CJ190_005520) | 1219330..1220400 | + | 1071 | WP_082888722.1 | IS30 family transposase | - |
CJ190_RS05525 (CJ190_005525) | 1221271..1221516 | + | 246 | WP_064293475.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
CJ190_RS05530 (CJ190_005530) | 1221510..1221842 | + | 333 | WP_064293476.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CJ190_RS05535 (CJ190_005535) | 1221966..1223132 | - | 1167 | WP_070598430.1 | nucleotide sugar dehydrogenase | - |
CJ190_RS05540 (CJ190_005540) | 1223197..1224045 | - | 849 | WP_143739149.1 | hypothetical protein | - |
CJ190_RS05545 (CJ190_005545) | 1224168..1225001 | - | 834 | WP_083307120.1 | RNA-directed DNA polymerase | - |
CJ190_RS05550 (CJ190_005550) | 1225098..1226336 | - | 1239 | WP_070598428.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | ugd / cps4J | 1216170..1235922 | 19752 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12768.93 Da Isoelectric Point: 9.5175
>T283402 WP_064293476.1 NZ_CP126958:1221510-1221842 [Aerococcus sp. UMB0080]
MVKVKQGSIIKINLDPKQGHEQKGYRPYICLSHGIVTKYSNIAIFAPISHTKRKYPFYVELEQTKTTGKVLLDQLVTIDF
NARDYKYIEQVPDDILIDLLARVKVLFEKE
MVKVKQGSIIKINLDPKQGHEQKGYRPYICLSHGIVTKYSNIAIFAPISHTKRKYPFYVELEQTKTTGKVLLDQLVTIDF
NARDYKYIEQVPDDILIDLLARVKVLFEKE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A178HCX2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A178HDW3 |