Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3616759..3617413 | Replicon | chromosome |
Accession | NZ_CP126955 | ||
Organism | Escherichia coli O78:H4 strain APEC E123 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QQA21_RS17830 | Protein ID | WP_000244777.1 |
Coordinates | 3616759..3617166 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QQA21_RS17835 | Protein ID | WP_000354046.1 |
Coordinates | 3617147..3617413 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA21_RS17810 (3612716) | 3612716..3614449 | - | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QQA21_RS17815 (3614455) | 3614455..3615165 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QQA21_RS17820 (3615190) | 3615190..3616086 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QQA21_RS17825 (3616198) | 3616198..3616719 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
QQA21_RS17830 (3616759) | 3616759..3617166 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
QQA21_RS17835 (3617147) | 3617147..3617413 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QQA21_RS17840 (3617656) | 3617656..3618636 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
QQA21_RS17845 (3618713) | 3618713..3619372 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
QQA21_RS17850 (3619536) | 3619536..3619847 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
QQA21_RS17855 (3619892) | 3619892..3621325 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
QQA21_RS17860 (3621382) | 3621382..3622125 | - | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T283388 WP_000244777.1 NZ_CP126955:c3617166-3616759 [Escherichia coli O78:H4]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |