Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3475222..3475805 | Replicon | chromosome |
Accession | NZ_CP126955 | ||
Organism | Escherichia coli O78:H4 strain APEC E123 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | QQA21_RS17170 | Protein ID | WP_000254738.1 |
Coordinates | 3475222..3475557 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QQA21_RS17175 | Protein ID | WP_000581937.1 |
Coordinates | 3475557..3475805 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA21_RS17155 (3471109) | 3471109..3472407 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
QQA21_RS17160 (3472495) | 3472495..3474132 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QQA21_RS17165 (3474360) | 3474360..3475151 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QQA21_RS17170 (3475222) | 3475222..3475557 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
QQA21_RS17175 (3475557) | 3475557..3475805 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QQA21_RS17180 (3475883) | 3475883..3478117 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QQA21_RS17185 (3478165) | 3478165..3479466 | - | 1302 | WP_000046838.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T283387 WP_000254738.1 NZ_CP126955:c3475557-3475222 [Escherichia coli O78:H4]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|