Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2630445..2631276 | Replicon | chromosome |
| Accession | NZ_CP126955 | ||
| Organism | Escherichia coli O78:H4 strain APEC E123 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QQA21_RS13120 | Protein ID | WP_069024963.1 |
| Coordinates | 2630902..2631276 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | QQA21_RS13115 | Protein ID | WP_001285585.1 |
| Coordinates | 2630445..2630813 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA21_RS13085 (2627349) | 2627349..2627804 | + | 456 | WP_000581504.1 | IrmA family protein | - |
| QQA21_RS13090 (2627883) | 2627883..2628116 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| QQA21_RS13095 (2628216) | 2628216..2629034 | + | 819 | WP_001234629.1 | DUF932 domain-containing protein | - |
| QQA21_RS13100 (2629116) | 2629116..2629595 | + | 480 | WP_000860087.1 | antirestriction protein | - |
| QQA21_RS13105 (2629611) | 2629611..2630087 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QQA21_RS13110 (2630150) | 2630150..2630371 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QQA21_RS13115 (2630445) | 2630445..2630813 | + | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QQA21_RS13120 (2630902) | 2630902..2631276 | + | 375 | WP_069024963.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QQA21_RS13125 (2631273) | 2631273..2631467 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QQA21_RS13130 (2631513) | 2631513..2631593 | + | 81 | Protein_2570 | hypothetical protein | - |
| QQA21_RS13135 (2631882) | 2631882..2632010 | - | 129 | Protein_2571 | transposase domain-containing protein | - |
| QQA21_RS13140 (2632130) | 2632130..2632264 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| QQA21_RS13145 (2632365) | 2632365..2632694 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| QQA21_RS13150 (2632866) | 2632866..2633924 | - | 1059 | WP_001200905.1 | FUSC family protein | - |
| QQA21_RS13155 (2634122) | 2634122..2634595 | - | 474 | WP_001105393.1 | DNA gyrase inhibitor SbmC | - |
| QQA21_RS13160 (2634714) | 2634714..2635880 | - | 1167 | WP_000830163.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.90 Da Isoelectric Point: 7.1328
>T283383 WP_069024963.1 NZ_CP126955:2630902-2631276 [Escherichia coli O78:H4]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGQYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGQYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT283383 WP_001285585.1 NZ_CP126955:2630445-2630813 [Escherichia coli O78:H4]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|