Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 984448..985066 | Replicon | chromosome |
Accession | NZ_CP126955 | ||
Organism | Escherichia coli O78:H4 strain APEC E123 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQA21_RS04950 | Protein ID | WP_001291435.1 |
Coordinates | 984448..984666 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQA21_RS04955 | Protein ID | WP_000344800.1 |
Coordinates | 984692..985066 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA21_RS04915 (979737) | 979737..980309 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
QQA21_RS04920 (980340) | 980340..980651 | - | 312 | WP_000409911.1 | MGMT family protein | - |
QQA21_RS04930 (981030) | 981030..981383 | + | 354 | Protein_968 | DUF1428 family protein | - |
QQA21_RS04935 (981425) | 981425..982975 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQA21_RS04940 (983139) | 983139..983609 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QQA21_RS04945 (983725) | 983725..984276 | - | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
QQA21_RS04950 (984448) | 984448..984666 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQA21_RS04955 (984692) | 984692..985066 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQA21_RS04960 (985612) | 985612..988761 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QQA21_RS04965 (988784) | 988784..989977 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283377 WP_001291435.1 NZ_CP126955:c984666-984448 [Escherichia coli O78:H4]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT283377 WP_000344800.1 NZ_CP126955:c985066-984692 [Escherichia coli O78:H4]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |