Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 122815..123650 | Replicon | chromosome |
| Accession | NZ_CP126955 | ||
| Organism | Escherichia coli O78:H4 strain APEC E123 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1C0Y405 |
| Locus tag | QQA21_RS00610 | Protein ID | WP_001774607.1 |
| Coordinates | 122815..123192 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M2U6P5 |
| Locus tag | QQA21_RS00615 | Protein ID | WP_001774606.1 |
| Coordinates | 123282..123650 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA21_RS00590 (118907) | 118907..120445 | - | 1539 | WP_001187182.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| QQA21_RS00595 (121194) | 121194..122036 | - | 843 | WP_032152755.1 | DUF4942 domain-containing protein | - |
| QQA21_RS00600 (122121) | 122121..122318 | - | 198 | WP_032152719.1 | DUF957 domain-containing protein | - |
| QQA21_RS00605 (122330) | 122330..122818 | - | 489 | WP_001774608.1 | DUF5983 family protein | - |
| QQA21_RS00610 (122815) | 122815..123192 | - | 378 | WP_001774607.1 | TA system toxin CbtA family protein | Toxin |
| QQA21_RS00615 (123282) | 123282..123650 | - | 369 | WP_001774606.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QQA21_RS00620 (123700) | 123700..124344 | - | 645 | WP_001774605.1 | hypothetical protein | - |
| QQA21_RS00625 (124363) | 124363..124584 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QQA21_RS00630 (124647) | 124647..125123 | - | 477 | WP_001297237.1 | RadC family protein | - |
| QQA21_RS00635 (125139) | 125139..125618 | - | 480 | WP_032152717.1 | antirestriction protein | - |
| QQA21_RS00640 (125712) | 125712..125957 | - | 246 | WP_016238868.1 | hypothetical protein | - |
| QQA21_RS00645 (125957) | 125957..126775 | - | 819 | WP_016238867.1 | DUF932 domain-containing protein | - |
| QQA21_RS00650 (126874) | 126874..127107 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| QQA21_RS00655 (127113) | 127113..127790 | - | 678 | WP_001097305.1 | hypothetical protein | - |
| QQA21_RS00660 (127938) | 127938..128618 | - | 681 | WP_032082725.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14218.20 Da Isoelectric Point: 7.8045
>T283375 WP_001774607.1 NZ_CP126955:c123192-122815 [Escherichia coli O78:H4]
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.31 Da Isoelectric Point: 5.8746
>AT283375 WP_001774606.1 NZ_CP126955:c123650-123282 [Escherichia coli O78:H4]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C0Y405 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2U6P5 |