Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelE-RHH |
Location | 109854..110401 | Replicon | plasmid pEND_Eco 12049-2 |
Accession | NZ_CP126954 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | parE | Uniprot ID | G7QEJ9 |
Locus tag | QQA22_RS26580 | Protein ID | WP_001384452.1 |
Coordinates | 110123..110401 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | E1QMW3 |
Locus tag | QQA22_RS26575 | Protein ID | WP_000079941.1 |
Coordinates | 109854..110123 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS26550 (105498) | 105498..106031 | - | 534 | WP_001303319.1 | transcription termination/antitermination NusG family protein | - |
QQA22_RS26555 (106473) | 106473..106760 | - | 288 | WP_000074849.1 | conjugal transfer protein TraA | - |
QQA22_RS26560 (106678) | 106678..106908 | - | 231 | WP_228772074.1 | ash family protein | - |
QQA22_RS26565 (107914) | 107914..108945 | + | 1032 | WP_000907873.1 | plasmid replication initiator RepA | - |
QQA22_RS26570 (109641) | 109641..109799 | + | 159 | WP_000841008.1 | hypothetical protein | - |
QQA22_RS26575 (109854) | 109854..110123 | + | 270 | WP_000079941.1 | type II toxin-antitoxin system antitoxin YacA | Antitoxin |
QQA22_RS26580 (110123) | 110123..110401 | + | 279 | WP_001384452.1 | type II toxin-antitoxin system toxin YacB | Toxin |
QQA22_RS26585 (110441) | 110441..111289 | + | 849 | WP_001057996.1 | 3'-5' exonuclease | - |
QQA22_RS26590 (111526) | 111526..111651 | - | 126 | Protein_122 | MerR family transcriptional regulator | - |
QQA22_RS26595 (111646) | 111646..113256 | + | 1611 | Protein_123 | DDE-type integrase/transposase/recombinase | - |
QQA22_RS26600 (113259) | 113259..114119 | + | 861 | WP_000344784.1 | TniB family NTP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / aac(3)-VIa / ant(3'')-Ia | - | 1..114229 | 114229 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10762.38 Da Isoelectric Point: 8.4615
>T283373 WP_001384452.1 NZ_CP126954:110123-110401 [Escherichia coli O78:H4]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CL36 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A629TXC5 |