283365

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 100371..101014 Replicon plasmid pEND_Eco 12049-1
Accession NZ_CP126953
Organism Escherichia coli O78:H4 strain APEC E12049

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QQA22_RS25640 Protein ID WP_001034044.1
Coordinates 100598..101014 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QQA22_RS25635 Protein ID WP_001261286.1
Coordinates 100371..100601 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA22_RS25600 (95544) 95544..95711 + 168 Protein_88 colicin-B -
QQA22_RS25605 (95729) 95729..96256 - 528 WP_000203272.1 colicin B immunity protein -
QQA22_RS25610 (96500) 96500..97315 + 816 WP_001312845.1 lipid II-degrading bacteriocin colicin M -
QQA22_RS25615 (97365) 97365..97718 - 354 WP_000864812.1 colicin M immunity protein -
QQA22_RS25620 (97896) 97896..98687 - 792 WP_000016494.1 site-specific integrase -
QQA22_RS25625 (98684) 98684..99373 - 690 WP_000796229.1 hypothetical protein -
QQA22_RS25630 (99417) 99417..99767 - 351 WP_000493379.1 hypothetical protein -
QQA22_RS25635 (100371) 100371..100601 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QQA22_RS25640 (100598) 100598..101014 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QQA22_RS25645 (101089) 101089..102654 + 1566 WP_001128474.1 AAA family ATPase -
QQA22_RS25650 (102639) 102639..103661 + 1023 WP_000361402.1 helicase UvrD -
QQA22_RS25660 (104739) 104739..105653 + 915 WP_000949004.1 iron/manganese ABC transporter substrate-binding protein SitA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA 1..155857 155857
- flank IS/Tn sitABCD - 103686..108188 4502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T283365 WP_001034044.1 NZ_CP126953:100598-101014 [Escherichia coli O78:H4]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT283365 WP_001261286.1 NZ_CP126953:100371-100601 [Escherichia coli O78:H4]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References