Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 100371..101014 | Replicon | plasmid pEND_Eco 12049-1 |
| Accession | NZ_CP126953 | ||
| Organism | Escherichia coli O78:H4 strain APEC E12049 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QQA22_RS25640 | Protein ID | WP_001034044.1 |
| Coordinates | 100598..101014 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QQA22_RS25635 | Protein ID | WP_001261286.1 |
| Coordinates | 100371..100601 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA22_RS25600 (95544) | 95544..95711 | + | 168 | Protein_88 | colicin-B | - |
| QQA22_RS25605 (95729) | 95729..96256 | - | 528 | WP_000203272.1 | colicin B immunity protein | - |
| QQA22_RS25610 (96500) | 96500..97315 | + | 816 | WP_001312845.1 | lipid II-degrading bacteriocin colicin M | - |
| QQA22_RS25615 (97365) | 97365..97718 | - | 354 | WP_000864812.1 | colicin M immunity protein | - |
| QQA22_RS25620 (97896) | 97896..98687 | - | 792 | WP_000016494.1 | site-specific integrase | - |
| QQA22_RS25625 (98684) | 98684..99373 | - | 690 | WP_000796229.1 | hypothetical protein | - |
| QQA22_RS25630 (99417) | 99417..99767 | - | 351 | WP_000493379.1 | hypothetical protein | - |
| QQA22_RS25635 (100371) | 100371..100601 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QQA22_RS25640 (100598) | 100598..101014 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQA22_RS25645 (101089) | 101089..102654 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QQA22_RS25650 (102639) | 102639..103661 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| QQA22_RS25660 (104739) | 104739..105653 | + | 915 | WP_000949004.1 | iron/manganese ABC transporter substrate-binding protein SitA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA | 1..155857 | 155857 | |
| - | flank | IS/Tn | sitABCD | - | 103686..108188 | 4502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T283365 WP_001034044.1 NZ_CP126953:100598-101014 [Escherichia coli O78:H4]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |