Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 30547..31082 Replicon plasmid pEND_Eco 12049-1
Accession NZ_CP126953
Organism Escherichia coli O78:H4 strain APEC E12049

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag QQA22_RS25330 Protein ID WP_000222766.1
Coordinates 30795..31082 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag QQA22_RS25325 Protein ID WP_001132900.1
Coordinates 30547..30798 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA22_RS25280 (25676) 25676..26023 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
QQA22_RS25285 (26023) 26023..26700 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
QQA22_RS25290 (26828) 26828..26902 + 75 Protein_26 endonuclease -
- (27158) 27158..27219 - 62 NuclAT_1 - -
- (27158) 27158..27219 - 62 NuclAT_1 - -
- (27158) 27158..27219 - 62 NuclAT_1 - -
- (27158) 27158..27219 - 62 NuclAT_1 - -
QQA22_RS25295 (27263) 27263..27412 + 150 WP_001312851.1 Hok/Gef family protein -
QQA22_RS25300 (27696) 27696..27953 + 258 WP_000083845.1 replication regulatory protein RepA -
QQA22_RS25305 (27970) 27970..28221 - 252 WP_223195197.1 replication protein RepA -
QQA22_RS25310 (28212) 28212..28259 + 48 WP_229471593.1 hypothetical protein -
QQA22_RS25315 (28252) 28252..28734 + 483 WP_001273588.1 hypothetical protein -
QQA22_RS25320 (28727) 28727..29584 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
QQA22_RS25325 (30547) 30547..30798 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQA22_RS25330 (30795) 30795..31082 + 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA 1..155857 155857
- inside IScluster/Tn - vat 24085..41408 17323


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T283363 WP_000222766.1 NZ_CP126953:30795-31082 [Escherichia coli O78:H4]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT283363 WP_001132900.1 NZ_CP126953:30547-30798 [Escherichia coli O78:H4]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References