Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 16169..16794 | Replicon | plasmid pEND_Eco 12049-1 |
Accession | NZ_CP126953 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QQA22_RS25245 | Protein ID | WP_000911333.1 |
Coordinates | 16169..16567 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | QQA22_RS25250 | Protein ID | WP_000450520.1 |
Coordinates | 16567..16794 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS25230 (12500) | 12500..13009 | + | 510 | WP_000628107.1 | conjugal transfer entry exclusion protein TraS | - |
QQA22_RS25235 (13023) | 13023..13754 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
QQA22_RS25240 (14007) | 14007..16160 | + | 2154 | WP_000009325.1 | type IV conjugative transfer system coupling protein TraD | - |
QQA22_RS25245 (16169) | 16169..16567 | - | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QQA22_RS25250 (16567) | 16567..16794 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | vat / iroB / iroC / iroD / iroE / iroN / iucA / iucB / iucC / iucD / iutA | 1..155857 | 155857 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T283359 WP_000911333.1 NZ_CP126953:c16567-16169 [Escherichia coli O78:H4]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|