Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4452356..4453170 | Replicon | chromosome |
| Accession | NZ_CP126952 | ||
| Organism | Escherichia coli O78:H4 strain APEC E12049 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | QQA22_RS21770 | Protein ID | WP_001054376.1 |
| Coordinates | 4452356..4452613 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | QQA22_RS21775 | Protein ID | WP_001309181.1 |
| Coordinates | 4452625..4453170 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQA22_RS21745 (4447644) | 4447644..4448750 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
| QQA22_RS21750 (4448815) | 4448815..4449795 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| QQA22_RS21755 (4449905) | 4449905..4450110 | + | 206 | Protein_4257 | HNH endonuclease | - |
| QQA22_RS21760 (4450378) | 4450378..4451618 | - | 1241 | Protein_4258 | helicase YjhR | - |
| QQA22_RS21765 (4451734) | 4451734..4451865 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| QQA22_RS21770 (4452356) | 4452356..4452613 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| QQA22_RS21775 (4452625) | 4452625..4453170 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| QQA22_RS21780 (4453226) | 4453226..4453972 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| QQA22_RS21785 (4454141) | 4454141..4454359 | + | 219 | Protein_4263 | hypothetical protein | - |
| QQA22_RS21790 (4454397) | 4454397..4454513 | + | 117 | Protein_4264 | VOC family protein | - |
| QQA22_RS21795 (4454758) | 4454758..4455879 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| QQA22_RS21800 (4455876) | 4455876..4456154 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| QQA22_RS21805 (4456166) | 4456166..4457479 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4442141..4468860 | 26719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T283356 WP_001054376.1 NZ_CP126952:4452356-4452613 [Escherichia coli O78:H4]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT283356 WP_001309181.1 NZ_CP126952:4452625-4453170 [Escherichia coli O78:H4]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|