Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4045766..4046564 Replicon chromosome
Accession NZ_CP126952
Organism Escherichia coli O78:H4 strain APEC E12049

Toxin (Protein)


Gene name yeeV Uniprot ID Q8VRA6
Locus tag QQA22_RS19835 Protein ID WP_000854730.1
Coordinates 4046187..4046564 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P0SQV8
Locus tag QQA22_RS19830 Protein ID WP_001285481.1
Coordinates 4045766..4046140 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQA22_RS19790 (4041741) 4041741..4042193 + 453 WP_000682723.1 hypothetical protein -
QQA22_RS19795 (4042311) 4042311..4042544 + 234 WP_001213776.1 DUF905 family protein -
QQA22_RS19800 (4042644) 4042644..4043465 + 822 WP_001234359.1 DUF932 domain-containing protein -
QQA22_RS19805 (4043465) 4043465..4043710 + 246 WP_001164966.1 hypothetical protein -
QQA22_RS19810 (4043804) 4043804..4044277 + 474 WP_289245607.1 antirestriction protein -
QQA22_RS19815 (4044293) 4044293..4044769 + 477 WP_001313574.1 RadC family protein -
QQA22_RS19820 (4044832) 4044832..4045053 + 222 WP_000692315.1 DUF987 domain-containing protein -
QQA22_RS19825 (4045072) 4045072..4045716 + 645 WP_000086759.1 hypothetical protein -
QQA22_RS19830 (4045766) 4045766..4046140 + 375 WP_001285481.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQA22_RS19835 (4046187) 4046187..4046564 + 378 WP_000854730.1 TA system toxin CbtA family protein Toxin
QQA22_RS19840 (4046561) 4046561..4047053 + 493 Protein_3884 DUF5983 family protein -
QQA22_RS19845 (4047132) 4047132..4048120 - 989 Protein_3885 IS630 family transposase -
QQA22_RS19850 (4048268) 4048268..4049861 - 1594 Protein_3886 IS66 family transposase -
QQA22_RS19855 (4049892) 4049892..4050242 - 351 WP_000624707.1 IS66 family insertion sequence element accessory protein TnpB -
QQA22_RS19860 (4050239) 4050239..4050530 - 292 Protein_3888 transposase -
QQA22_RS19865 (4050572) 4050572..4050766 + 195 WP_001313570.1 DUF957 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14212.21 Da        Isoelectric Point: 7.2923

>T283355 WP_000854730.1 NZ_CP126952:4046187-4046564 [Escherichia coli O78:H4]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13817.53 Da        Isoelectric Point: 4.7511

>AT283355 WP_001285481.1 NZ_CP126952:4045766-4046140 [Escherichia coli O78:H4]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V671

Antitoxin

Source ID Structure
AlphaFold DB A0A0P0SQV8

References