Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3886005..3886840 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
Locus tag | QQA22_RS19095 | Protein ID | WP_000854821.1 |
Coordinates | 3886005..3886382 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0D404 |
Locus tag | QQA22_RS19100 | Protein ID | WP_024214935.1 |
Coordinates | 3886472..3886840 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS19065 (3881607) | 3881607..3882101 | + | 495 | WP_001059463.1 | MarR family transcriptional regulator | - |
QQA22_RS19070 (3882539) | 3882539..3882874 | - | 336 | Protein_3731 | Arm DNA-binding domain-containing protein | - |
QQA22_RS19075 (3883241) | 3883241..3884560 | + | 1320 | WP_000144688.1 | site-specific integrase | - |
QQA22_RS19080 (3884653) | 3884653..3885501 | - | 849 | WP_001280470.1 | DUF4942 domain-containing protein | - |
QQA22_RS19085 (3885586) | 3885586..3885783 | - | 198 | WP_089075429.1 | DUF957 domain-containing protein | - |
QQA22_RS19090 (3885811) | 3885811..3886008 | - | 198 | Protein_3735 | DUF5983 family protein | - |
QQA22_RS19095 (3886005) | 3886005..3886382 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QQA22_RS19100 (3886472) | 3886472..3886840 | - | 369 | WP_024214935.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QQA22_RS19105 (3886920) | 3886920..3887141 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
QQA22_RS19110 (3887228) | 3887228..3887704 | - | 477 | WP_001186745.1 | RadC family protein | - |
QQA22_RS19115 (3887720) | 3887720..3888205 | - | 486 | WP_024214936.1 | antirestriction protein | - |
QQA22_RS19120 (3888297) | 3888297..3889061 | - | 765 | WP_289245668.1 | DUF932 domain-containing protein | - |
QQA22_RS19125 (3889264) | 3889264..3890805 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
QQA22_RS19130 (3890820) | 3890820..3891566 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T283354 WP_000854821.1 NZ_CP126952:c3886382-3886005 [Escherichia coli O78:H4]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13605.41 Da Isoelectric Point: 6.4659
>AT283354 WP_024214935.1 NZ_CP126952:c3886840-3886472 [Escherichia coli O78:H4]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W4PV54 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0D404 |