Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3679317..3679935 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQA22_RS18130 | Protein ID | WP_001291435.1 |
Coordinates | 3679717..3679935 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A8S7S0Y3 |
Locus tag | QQA22_RS18125 | Protein ID | WP_039004128.1 |
Coordinates | 3679317..3679691 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS18115 (3674406) | 3674406..3675599 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QQA22_RS18120 (3675622) | 3675622..3678771 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QQA22_RS18125 (3679317) | 3679317..3679691 | + | 375 | WP_039004128.1 | Hha toxicity modulator TomB | Antitoxin |
QQA22_RS18130 (3679717) | 3679717..3679935 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQA22_RS18135 (3680107) | 3680107..3680658 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QQA22_RS18140 (3680774) | 3680774..3681244 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QQA22_RS18145 (3681408) | 3681408..3682958 | + | 1551 | WP_001317659.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQA22_RS18150 (3683000) | 3683000..3683353 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QQA22_RS18160 (3683732) | 3683732..3684043 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QQA22_RS18165 (3684074) | 3684074..3684646 | - | 573 | WP_000779821.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T283353 WP_001291435.1 NZ_CP126952:3679717-3679935 [Escherichia coli O78:H4]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14587.42 Da Isoelectric Point: 4.7395
>AT283353 WP_039004128.1 NZ_CP126952:3679317-3679691 [Escherichia coli O78:H4]
MDEYSPKRHDITQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDITQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|