Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3261949..3262654 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QQA22_RS15940 | Protein ID | WP_289245592.1 |
Coordinates | 3261949..3262335 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QQA22_RS15945 | Protein ID | WP_001280945.1 |
Coordinates | 3262325..3262654 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS15920 (3257953) | 3257953..3258579 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
QQA22_RS15925 (3258576) | 3258576..3259691 | - | 1116 | Protein_3118 | aldose sugar dehydrogenase YliI | - |
QQA22_RS15930 (3259802) | 3259802..3260185 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
QQA22_RS15935 (3260398) | 3260398..3261723 | + | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
QQA22_RS15940 (3261949) | 3261949..3262335 | + | 387 | WP_289245592.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQA22_RS15945 (3262325) | 3262325..3262654 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
QQA22_RS15950 (3262724) | 3262724..3264052 | - | 1329 | WP_000086919.1 | GGDEF domain-containing protein | - |
QQA22_RS15955 (3264060) | 3264060..3266408 | - | 2349 | Protein_3124 | EAL domain-containing protein | - |
QQA22_RS15960 (3266586) | 3266586..3267497 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14305.51 Da Isoelectric Point: 9.9296
>T283351 WP_289245592.1 NZ_CP126952:3261949-3262335 [Escherichia coli O78:H4]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGIKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGIKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|