Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3010644..3011428 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | QQA22_RS14740 | Protein ID | WP_000613624.1 |
Coordinates | 3010934..3011428 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | QQA22_RS14735 | Protein ID | WP_039004735.1 |
Coordinates | 3010644..3010937 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS14725 (3005793) | 3005793..3006752 | - | 960 | WP_000846329.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
QQA22_RS14730 (3007325) | 3007325..3010510 | + | 3186 | WP_039004731.1 | ribonuclease E | - |
QQA22_RS14735 (3010644) | 3010644..3010937 | + | 294 | WP_039004735.1 | DUF1778 domain-containing protein | Antitoxin |
QQA22_RS14740 (3010934) | 3010934..3011428 | + | 495 | WP_000613624.1 | GNAT family N-acetyltransferase | Toxin |
QQA22_RS14745 (3011523) | 3011523..3012476 | - | 954 | WP_001212762.1 | flagellar hook-associated protein FlgL | - |
QQA22_RS14750 (3012488) | 3012488..3014131 | - | 1644 | WP_000096482.1 | flagellar hook-associated protein FlgK | - |
QQA22_RS14755 (3014197) | 3014197..3015138 | - | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
QQA22_RS14760 (3015138) | 3015138..3016235 | - | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18142.04 Da Isoelectric Point: 7.7444
>T283350 WP_000613624.1 NZ_CP126952:3010934-3011428 [Escherichia coli O78:H4]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|