Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 987492..988146 | Replicon | chromosome |
Accession | NZ_CP126952 | ||
Organism | Escherichia coli O78:H4 strain APEC E12049 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QQA22_RS04850 | Protein ID | WP_000244781.1 |
Coordinates | 987739..988146 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QQA22_RS04845 | Protein ID | WP_000354046.1 |
Coordinates | 987492..987758 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQA22_RS04825 (983570) | 983570..985003 | - | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
QQA22_RS04830 (985048) | 985048..985359 | + | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
QQA22_RS04835 (985523) | 985523..986182 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
QQA22_RS04840 (986259) | 986259..987239 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
QQA22_RS04845 (987492) | 987492..987758 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QQA22_RS04850 (987739) | 987739..988146 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QQA22_RS04855 (988186) | 988186..988707 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QQA22_RS04860 (988819) | 988819..989715 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QQA22_RS04865 (989740) | 989740..990450 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QQA22_RS04870 (990456) | 990456..992189 | + | 1734 | WP_000813191.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T283340 WP_000244781.1 NZ_CP126952:987739-988146 [Escherichia coli O78:H4]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |